Cp4.1LG16g06850.1 (mRNA) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTCATTGTCTTTGAAGATTAGGTAATCAACCAATCGACCAATACCAAAATTTGGCCCCATCTTTATATTAAATGCTACTTTTCCTCTATTTGTTCATGTTTGAAGTGCATAAATAGAGCCCTTAGTCAAGCCACAATCCATGTCCACCACACCACACTCCTCTTCTTTCCCAACCAAAATGGGTATCACCACTTCTCATACCCCAAAATATGTAGTGACTTTTGCCTTAGCTTTGCAGCTGGTCTTCCTTTTGATGGGCAGCTCCTCAGCCCAGCTCTCCACTTCCTTCTACTCCAAGACCTGTCCCAAGCTCCTCCGGATCGTCCGCTCGGGCGTCCAATCCGCCATCGCTAAGGAAACCCGCATGGGCGCTTCCCTTCTCCGTCTCCACTTCCATGACTGCTTTGTTAAC ATGAAGCCCTTAGTCAAGCCACAATCCATGTCCACCACACCACACTCCTCTTCTTTCCCAACCAAAATGGGTATCACCACTTCTCATACCCCAAAATATGTAGTGACTTTTGCCTTAGCTTTGCAGCTGGTCTTCCTTTTGATGGGCAGCTCCTCAGCCCAGCTCTCCACTTCCTTCTACTCCAAGACCTGTCCCAAGCTCCTCCGGATCGTCCGCTCGGGCGTCCAATCCGCCATCGCTAAGGAAACCCGCATGGGCGCTTCCCTTCTCCGTCTCCACTTCCATGACTGCTTTGTTAAC ATGAAGCCCTTAGTCAAGCCACAATCCATGTCCACCACACCACACTCCTCTTCTTTCCCAACCAAAATGGGTATCACCACTTCTCATACCCCAAAATATGTAGTGACTTTTGCCTTAGCTTTGCAGCTGGTCTTCCTTTTGATGGGCAGCTCCTCAGCCCAGCTCTCCACTTCCTTCTACTCCAAGACCTGTCCCAAGCTCCTCCGGATCGTCCGCTCGGGCGTCCAATCCGCCATCGCTAAGGAAACCCGCATGGGCGCTTCCCTTCTCCGTCTCCACTTCCATGACTGCTTTGTTAAC MKPLVKPQSMSTTPHSSSFPTKMGITTSHTPKYVVTFALALQLVFLLMGSSSAQLSTSFYSKTCPKLLRIVRSGVQSAIAKETRMGASLLRLHFHDCFVN
BLAST of Cp4.1LG16g06850.1 vs. Swiss-Prot
Match: PER4_VITVI (Peroxidase 4 OS=Vitis vinifera GN=GSVIVT00023967001 PE=1 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 5.0e-18 Identity = 45/62 (72.58%), Postives = 53/62 (85.48%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. Swiss-Prot
Match: PER1_ARAHY (Cationic peroxidase 1 OS=Arachis hypogaea GN=PNC1 PE=1 SV=2) HSP 1 Score: 77.4 bits (189), Expect = 9.8e-14 Identity = 37/58 (63.79%), Postives = 46/58 (79.31%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. Swiss-Prot
Match: PER53_ARATH (Peroxidase 53 OS=Arabidopsis thaliana GN=PER53 PE=1 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.3e-13 Identity = 35/58 (60.34%), Postives = 45/58 (77.59%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. Swiss-Prot
Match: PER66_MAIZE (Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.9e-13 Identity = 37/62 (59.68%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. Swiss-Prot
Match: PER54_ARATH (Peroxidase 54 OS=Arabidopsis thaliana GN=PER54 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.9e-12 Identity = 37/78 (47.44%), Postives = 50/78 (64.10%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. TrEMBL
Match: A0A068J7H5_MOMCH (Peroxidase OS=Momordica charantia PE=2 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.5e-24 Identity = 62/78 (79.49%), Postives = 68/78 (87.18%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. TrEMBL
Match: A0A0A0KHH0_CUCSA (Peroxidase OS=Cucumis sativus GN=Csa_6G213910 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 3.6e-23 Identity = 56/74 (75.68%), Postives = 62/74 (83.78%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. TrEMBL
Match: A0A0A0L018_CUCSA (Peroxidase OS=Cucumis sativus GN=Csa_4G626600 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 3.6e-23 Identity = 56/74 (75.68%), Postives = 62/74 (83.78%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. TrEMBL
Match: A0A067DIZ2_CITSI (Peroxidase OS=Citrus sinensis GN=CISIN_1g020615mg PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 3.9e-17 Identity = 49/67 (73.13%), Postives = 55/67 (82.09%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. TrEMBL
Match: A0A067DSE4_CITSI (Peroxidase OS=Citrus sinensis GN=CISIN_1g020615mg PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 3.9e-17 Identity = 49/67 (73.13%), Postives = 55/67 (82.09%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. TAIR10
Match: AT5G06720.1 (AT5G06720.1 peroxidase 2) HSP 1 Score: 77.0 bits (188), Expect = 7.2e-15 Identity = 35/58 (60.34%), Postives = 45/58 (77.59%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. TAIR10
Match: AT5G06730.1 (AT5G06730.1 Peroxidase superfamily protein) HSP 1 Score: 73.2 bits (178), Expect = 1.0e-13 Identity = 37/78 (47.44%), Postives = 50/78 (64.10%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. TAIR10
Match: AT5G58390.1 (AT5G58390.1 Peroxidase superfamily protein) HSP 1 Score: 72.8 bits (177), Expect = 1.4e-13 Identity = 33/60 (55.00%), Postives = 43/60 (71.67%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. TAIR10
Match: AT5G05340.1 (AT5G05340.1 Peroxidase superfamily protein) HSP 1 Score: 71.2 bits (173), Expect = 4.0e-13 Identity = 36/66 (54.55%), Postives = 47/66 (71.21%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. TAIR10
Match: AT1G14540.1 (AT1G14540.1 Peroxidase superfamily protein) HSP 1 Score: 69.7 bits (169), Expect = 1.2e-12 Identity = 33/60 (55.00%), Postives = 43/60 (71.67%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. NCBI nr
Match: gi|661349898|gb|AIE12239.1| (peroxide [Momordica charantia]) HSP 1 Score: 119.4 bits (298), Expect = 3.6e-24 Identity = 62/78 (79.49%), Postives = 68/78 (87.18%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. NCBI nr
Match: gi|449465781|ref|XP_004150606.1| (PREDICTED: peroxidase P7-like [Cucumis sativus]) HSP 1 Score: 115.5 bits (288), Expect = 5.2e-23 Identity = 56/74 (75.68%), Postives = 62/74 (83.78%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. NCBI nr
Match: gi|700199900|gb|KGN55058.1| (hypothetical protein Csa_4G626600 [Cucumis sativus]) HSP 1 Score: 115.5 bits (288), Expect = 5.2e-23 Identity = 56/74 (75.68%), Postives = 62/74 (83.78%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. NCBI nr
Match: gi|659130694|ref|XP_008465299.1| (PREDICTED: peroxidase 4-like [Cucumis melo]) HSP 1 Score: 114.8 bits (286), Expect = 8.9e-23 Identity = 59/75 (78.67%), Postives = 65/75 (86.67%), Query Frame = 1
BLAST of Cp4.1LG16g06850.1 vs. NCBI nr
Match: gi|659130692|ref|XP_008465298.1| (PREDICTED: peroxidase 4-like [Cucumis melo]) HSP 1 Score: 98.2 bits (243), Expect = 8.6e-18 Identity = 51/76 (67.11%), Postives = 60/76 (78.95%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
|