CmaCh20G007830.1 (mRNA) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGATTCGGTTTCTATCTTTGGTTCCTCATGCCAAGCAAATTCTGAAGATGCAGTCAGGTTTCACCAAAAACCAGTTGGATGTTCCGAAAGGCCATGTTGCAGTTTATGTGGGAGAGATCCAAAGGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACCATCCATCGTTCCAGCAACTGCTCAGTCACGCAGAGGAGAAGTTTGGATTCCATCATCCTCAAGGGGGACTAACAATTCCTTGCAAAGAAGATGCCTTCATCGATCTTACTTCTAGACTGCAAGTATCTTGA ATGGGGATTCGGTTTCTATCTTTGGTTCCTCATGCCAAGCAAATTCTGAAGATGCAGTCAGGTTTCACCAAAAACCAGTTGGATGTTCCGAAAGGCCATGTTGCAGTTTATGTGGGAGAGATCCAAAGGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACCATCCATCGTTCCAGCAACTGCTCAGTCACGCAGAGGAGAAGTTTGGATTCCATCATCCTCAAGGGGGACTAACAATTCCTTGCAAAGAAGATGCCTTCATCGATCTTACTTCTAGACTGCAAGTATCTTGA ATGGGGATTCGGTTTCTATCTTTGGTTCCTCATGCCAAGCAAATTCTGAAGATGCAGTCAGGTTTCACCAAAAACCAGTTGGATGTTCCGAAAGGCCATGTTGCAGTTTATGTGGGAGAGATCCAAAGGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACCATCCATCGTTCCAGCAACTGCTCAGTCACGCAGAGGAGAAGTTTGGATTCCATCATCCTCAAGGGGGACTAACAATTCCTTGCAAAGAAGATGCCTTCATCGATCTTACTTCTAGACTGCAAGTATCTTGA MGIRFLSLVPHAKQILKMQSGFTKNQLDVPKGHVAVYVGEIQRKRFVVPISYLNHPSFQQLLSHAEEKFGFHHPQGGLTIPCKEDAFIDLTSRLQVS
BLAST of CmaCh20G007830.1 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.0e-23 Identity = 53/84 (63.10%), Postives = 64/84 (76.19%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.0e-23 Identity = 51/79 (64.56%), Postives = 60/79 (75.95%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.1e-22 Identity = 47/66 (71.21%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.9e-22 Identity = 47/66 (71.21%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.5e-22 Identity = 47/65 (72.31%), Postives = 56/65 (86.15%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. TrEMBL
Match: A0A0A0LPI0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258720 PE=4 SV=1) HSP 1 Score: 188.3 bits (477), Expect = 4.3e-45 Identity = 89/97 (91.75%), Postives = 93/97 (95.88%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. TrEMBL
Match: A0A0A0LLF1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258700 PE=4 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 6.2e-44 Identity = 86/97 (88.66%), Postives = 92/97 (94.85%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. TrEMBL
Match: A0A0A0LIZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258760 PE=4 SV=1) HSP 1 Score: 183.3 bits (464), Expect = 1.4e-43 Identity = 85/97 (87.63%), Postives = 92/97 (94.85%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. TrEMBL
Match: A0A0A0LJA3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258790 PE=4 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 3.4e-42 Identity = 86/97 (88.66%), Postives = 90/97 (92.78%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. TrEMBL
Match: A0A0A0LJ99_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258740 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 5.8e-42 Identity = 83/97 (85.57%), Postives = 90/97 (92.78%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.9 bits (294), Expect = 3.6e-27 Identity = 57/98 (58.16%), Postives = 73/98 (74.49%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. TAIR10
Match: AT4G34810.1 (AT4G34810.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.5 bits (293), Expect = 4.7e-27 Identity = 60/105 (57.14%), Postives = 77/105 (73.33%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 116.7 bits (291), Expect = 8.0e-27 Identity = 57/97 (58.76%), Postives = 70/97 (72.16%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.5 bits (275), Expect = 5.7e-25 Identity = 53/84 (63.10%), Postives = 64/84 (76.19%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. TAIR10
Match: AT4G34790.1 (AT4G34790.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.5 bits (275), Expect = 5.7e-25 Identity = 56/102 (54.90%), Postives = 72/102 (70.59%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. NCBI nr
Match: gi|659115596|ref|XP_008457635.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 191.0 bits (484), Expect = 9.4e-46 Identity = 90/97 (92.78%), Postives = 94/97 (96.91%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. NCBI nr
Match: gi|700206757|gb|KGN61876.1| (hypothetical protein Csa_2G258720 [Cucumis sativus]) HSP 1 Score: 188.3 bits (477), Expect = 6.1e-45 Identity = 89/97 (91.75%), Postives = 93/97 (95.88%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. NCBI nr
Match: gi|778674175|ref|XP_011650154.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 184.5 bits (467), Expect = 8.8e-44 Identity = 86/97 (88.66%), Postives = 92/97 (94.85%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. NCBI nr
Match: gi|659115592|ref|XP_008457632.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 184.1 bits (466), Expect = 1.2e-43 Identity = 87/97 (89.69%), Postives = 93/97 (95.88%), Query Frame = 1
BLAST of CmaCh20G007830.1 vs. NCBI nr
Match: gi|700206761|gb|KGN61880.1| (hypothetical protein Csa_2G258760 [Cucumis sativus]) HSP 1 Score: 183.3 bits (464), Expect = 2.0e-43 Identity = 85/97 (87.63%), Postives = 92/97 (94.85%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
|