Cla97C05G087600.1 (mRNA) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTCTTCCAATCCGCCATTCAAATCCAGACCAGAATCCAAATACACCAAGGCCAAGAGAGCGCTCCGATCACTCGCCGTCTCCGTCGCCATTCCCCTCTTCCTAACAATCGCCGTCATCTTCCTCTTCGGTCGCTCCGCTCGCCATTTCCCCAATCGGAACCGTCCCATTTGGATACCACCGCTCTGGTTTCTCCATCTCTCCTCCATTGGCTCCTCCTTTCTAATCGGCCTCGCCGCTTGGCTCGTTTGGGCGGACGGTGGTTTCCACGGCGGTTCCAACGCTCTTCCGCTCTACATCGCGCATCTTTCTCTTAGCGTCGTTTGGAATCCTCTGGTGCTCGTGATTCGCTCTGTCATGCTTGCGTTTCTGTTCTGCGTTTTGGATTTTGTTACTCTGTTTGCTTGTTATCGGACCTTCAAGCGAGTCAATCCCTTCGCTAAGGATCTGATTAAGCCTTGTTTGGCTTGGACTGCGTATCTCTCTGCTATTACTTATGTGTTCATTGATCTTTGA ATGTCTTCTTCCAATCCGCCATTCAAATCCAGACCAGAATCCAAATACACCAAGGCCAAGAGAGCGCTCCGATCACTCGCCGTCTCCGTCGCCATTCCCCTCTTCCTAACAATCGCCGTCATCTTCCTCTTCGGTCGCTCCGCTCGCCATTTCCCCAATCGGAACCGTCCCATTTGGATACCACCGCTCTGGTTTCTCCATCTCTCCTCCATTGGCTCCTCCTTTCTAATCGGCCTCGCCGCTTGGCTCGTTTGGGCGGACGGTGGTTTCCACGGCGGTTCCAACGCTCTTCCGCTCTACATCGCGCATCTTTCTCTTAGCGTCGTTTGGAATCCTCTGGTGCTCGTGATTCGCTCTGTCATGCTTGCGTTTCTGTTCTGCGTTTTGGATTTTGTTACTCTGTTTGCTTGTTATCGGACCTTCAAGCGAGTCAATCCCTTCGCTAAGGATCTGATTAAGCCTTGTTTGGCTTGGACTGCGTATCTCTCTGCTATTACTTATGTGTTCATTGATCTTTGA ATGTCTTCTTCCAATCCGCCATTCAAATCCAGACCAGAATCCAAATACACCAAGGCCAAGAGAGCGCTCCGATCACTCGCCGTCTCCGTCGCCATTCCCCTCTTCCTAACAATCGCCGTCATCTTCCTCTTCGGTCGCTCCGCTCGCCATTTCCCCAATCGGAACCGTCCCATTTGGATACCACCGCTCTGGTTTCTCCATCTCTCCTCCATTGGCTCCTCCTTTCTAATCGGCCTCGCCGCTTGGCTCGTTTGGGCGGACGGTGGTTTCCACGGCGGTTCCAACGCTCTTCCGCTCTACATCGCGCATCTTTCTCTTAGCGTCGTTTGGAATCCTCTGGTGCTCGTGATTCGCTCTGTCATGCTTGCGTTTCTGTTCTGCGTTTTGGATTTTGTTACTCTGTTTGCTTGTTATCGGACCTTCAAGCGAGTCAATCCCTTCGCTAAGGATCTGATTAAGCCTTGTTTGGCTTGGACTGCGTATCTCTCTGCTATTACTTATGTGTTCATTGATCTTTGA MSSSNPPFKSRPESKYTKAKRALRSLAVSVAIPLFLTIAVIFLFGRSARHFPNRNRPIWIPPLWFLHLSSIGSSFLIGLAAWLVWADGGFHGGSNALPLYIAHLSLSVVWNPLVLVIRSVMLAFLFCVLDFVTLFACYRTFKRVNPFAKDLIKPCLAWTAYLSAITYVFIDL
BLAST of Cla97C05G087600.1 vs. NCBI nr
Match: XP_022973726.1 (translocator protein homolog [Cucurbita maxima] >XP_022975172.1 translocator protein homolog [Cucurbita maxima]) HSP 1 Score: 315.1 bits (806), Expect = 1.5e-82 Identity = 156/170 (91.76%), Postives = 164/170 (96.47%), Query Frame = 0
BLAST of Cla97C05G087600.1 vs. NCBI nr
Match: XP_016898980.1 (PREDICTED: translocator protein homolog [Cucumis melo]) HSP 1 Score: 314.7 bits (805), Expect = 2.0e-82 Identity = 156/172 (90.70%), Postives = 165/172 (95.93%), Query Frame = 0
BLAST of Cla97C05G087600.1 vs. NCBI nr
Match: XP_023540366.1 (translocator protein homolog [Cucurbita pepo subsp. pepo]) HSP 1 Score: 312.8 bits (800), Expect = 7.4e-82 Identity = 155/170 (91.18%), Postives = 163/170 (95.88%), Query Frame = 0
BLAST of Cla97C05G087600.1 vs. NCBI nr
Match: XP_004134488.1 (PREDICTED: translocator protein homolog [Cucumis sativus] >KGN57105.1 hypothetical protein Csa_3G154290 [Cucumis sativus]) HSP 1 Score: 311.6 bits (797), Expect = 1.7e-81 Identity = 154/172 (89.53%), Postives = 163/172 (94.77%), Query Frame = 0
BLAST of Cla97C05G087600.1 vs. NCBI nr
Match: XP_022945022.1 (translocator protein homolog [Cucurbita moschata]) HSP 1 Score: 311.2 bits (796), Expect = 2.2e-81 Identity = 155/170 (91.18%), Postives = 162/170 (95.29%), Query Frame = 0
BLAST of Cla97C05G087600.1 vs. TrEMBL
Match: tr|A0A1S4DTF2|A0A1S4DTF2_CUCME (translocator protein homolog OS=Cucumis melo OX=3656 GN=LOC107990392 PE=4 SV=1) HSP 1 Score: 314.7 bits (805), Expect = 1.3e-82 Identity = 156/172 (90.70%), Postives = 165/172 (95.93%), Query Frame = 0
BLAST of Cla97C05G087600.1 vs. TrEMBL
Match: tr|A0A0A0L583|A0A0A0L583_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G154290 PE=4 SV=1) HSP 1 Score: 311.6 bits (797), Expect = 1.1e-81 Identity = 154/172 (89.53%), Postives = 163/172 (94.77%), Query Frame = 0
BLAST of Cla97C05G087600.1 vs. TrEMBL
Match: tr|A0A2P5E491|A0A2P5E491_PARAD (TspO/MBR-related protein OS=Parasponia andersonii OX=3476 GN=PanWU01x14_008040 PE=4 SV=1) HSP 1 Score: 205.7 bits (522), Expect = 8.4e-50 Identity = 100/163 (61.35%), Postives = 124/163 (76.07%), Query Frame = 0
BLAST of Cla97C05G087600.1 vs. TrEMBL
Match: tr|A0A061EW61|A0A061EW61_THECC (TSPO(Outer membrane tryptophan-rich sensory protein)-related, putative OS=Theobroma cacao OX=3641 GN=TCM_021206 PE=4 SV=1) HSP 1 Score: 201.1 bits (510), Expect = 2.1e-48 Identity = 94/167 (56.29%), Postives = 125/167 (74.85%), Query Frame = 0
BLAST of Cla97C05G087600.1 vs. TrEMBL
Match: tr|A0A2H5N763|A0A2H5N763_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_019380 PE=4 SV=1) HSP 1 Score: 194.9 bits (494), Expect = 1.5e-46 Identity = 91/170 (53.53%), Postives = 128/170 (75.29%), Query Frame = 0
BLAST of Cla97C05G087600.1 vs. Swiss-Prot
Match: sp|O82245|TSPO_ARATH (Translocator protein homolog OS=Arabidopsis thaliana OX=3702 GN=TSPO PE=1 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 6.9e-31 Identity = 66/157 (42.04%), Postives = 94/157 (59.87%), Query Frame = 0
BLAST of Cla97C05G087600.1 vs. Swiss-Prot
Match: sp|Q5TGU0|TSPO2_HUMAN (Translocator protein 2 OS=Homo sapiens OX=9606 GN=TSPO2 PE=1 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 4.2e-04 Identity = 37/112 (33.04%), Postives = 55/112 (49.11%), Query Frame = 0
BLAST of Cla97C05G087600.1 vs. TAIR10
Match: AT2G47770.1 (TSPO(outer membrane tryptophan-rich sensory protein)-related) HSP 1 Score: 135.2 bits (339), Expect = 3.8e-32 Identity = 66/157 (42.04%), Postives = 94/157 (59.87%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
|