Cla97C05G085590.1 (mRNA) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGGATTGCAAAGGTACGAAACGACTTGTTGTCTGTTTAACATAAATGTTTTTAGTCATTATTTATGTGGGTTTTCTATAGGGTGTTTTAATTTGTATAATATTTTGAAGAAGGTATGATAACTTAAATATTTTTTTCCTAACTCAAATTATTAATTATGTTAACATAAAAATTTGTTGATAATTGGTATATTAATGCAGGCAAGAGCTCTTGGCCCGAGTTGGTTGGAGTTTTGGGAGACGTAGCTCAAAAGATTATTGAGAAAGAGAATCATTATGTTCATGCAAGAGTTGTTGAAGAAGGAACATTTGTTACACAAGATTTCAGGTGTGATAGGGTTTGGGTTTGGGTTGATAAGTACACCCACATTGTTATAATTACTCCTGTAATTGGTTGA ATGTCGGATTGCAAAGGCAAGAGCTCTTGGCCCGAGTTGGTTGGAGTTTTGGGAGACGTAGCTCAAAAGATTATTGAGAAAGAGAATCATTATGTTCATGCAAGAGTTGTTGAAGAAGGAACATTTGTTACACAAGATTTCAGGTGTGATAGGGTTTGGGTTTGGGTTGATAAGTACACCCACATTGTTATAATTACTCCTGTAATTGGTTGA ATGTCGGATTGCAAAGGCAAGAGCTCTTGGCCCGAGTTGGTTGGAGTTTTGGGAGACGTAGCTCAAAAGATTATTGAGAAAGAGAATCATTATGTTCATGCAAGAGTTGTTGAAGAAGGAACATTTGTTACACAAGATTTCAGGTGTGATAGGGTTTGGGTTTGGGTTGATAAGTACACCCACATTGTTATAATTACTCCTGTAATTGGTTGA MSDCKGKSSWPELVGVLGDVAQKIIEKENHYVHARVVEEGTFVTQDFRCDRVWVWVDKYTHIVIITPVIG
BLAST of Cla97C05G085590.1 vs. NCBI nr
Match: XP_016898985.1 (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis melo]) HSP 1 Score: 126.7 bits (317), Expect = 3.1e-26 Identity = 55/68 (80.88%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. NCBI nr
Match: KGN56905.1 (hypothetical protein Csa_3G142970 [Cucumis sativus]) HSP 1 Score: 124.0 bits (310), Expect = 2.0e-25 Identity = 55/68 (80.88%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. NCBI nr
Match: XP_004134090.1 (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus] >KGN56904.1 hypothetical protein Csa_3G142960 [Cucumis sativus]) HSP 1 Score: 100.5 bits (249), Expect = 2.4e-18 Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. NCBI nr
Match: POE98893.1 (glu s.griseus protease inhibitor [Quercus suber]) HSP 1 Score: 93.6 bits (231), Expect = 2.9e-16 Identity = 46/69 (66.67%), Postives = 51/69 (73.91%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. NCBI nr
Match: PON31726.1 (Proteinase inhibitor [Parasponia andersonii] >PON95050.1 Proteinase inhibitor [Trema orientalis]) HSP 1 Score: 92.8 bits (229), Expect = 4.9e-16 Identity = 45/67 (67.16%), Postives = 51/67 (76.12%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. TrEMBL
Match: tr|A0A1S4DTF7|A0A1S4DTF7_CUCME (inhibitor of trypsin and hageman factor-like OS=Cucumis melo OX=3656 GN=LOC103483638 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 2.0e-26 Identity = 55/68 (80.88%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. TrEMBL
Match: tr|A0A0A0L4J0|A0A0A0L4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142970 PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.3e-25 Identity = 55/68 (80.88%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. TrEMBL
Match: tr|A0A0A0L795|A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.6e-18 Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. TrEMBL
Match: tr|A0A2P4L0Z6|A0A2P4L0Z6_QUESU (Glu s.griseus protease inhibitor OS=Quercus suber OX=58331 GN=CFP56_44655 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.9e-16 Identity = 46/69 (66.67%), Postives = 51/69 (73.91%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. TrEMBL
Match: tr|A0A2P5FB87|A0A2P5FB87_9ROSA (Proteinase inhibitor OS=Trema orientalis OX=63057 GN=TorRG33x02_092490 PE=4 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 3.2e-16 Identity = 45/67 (67.16%), Postives = 51/67 (76.12%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. Swiss-Prot
Match: sp|P19873|ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.4e-14 Identity = 40/69 (57.97%), Postives = 51/69 (73.91%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. Swiss-Prot
Match: sp|P82381|ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 7.7e-13 Identity = 31/56 (55.36%), Postives = 44/56 (78.57%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. Swiss-Prot
Match: sp|P24076|BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 5.0e-12 Identity = 37/69 (53.62%), Postives = 45/69 (65.22%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. Swiss-Prot
Match: sp|P80211|ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 4.2e-11 Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. Swiss-Prot
Match: sp|Q6XNP7|HPI_HEVBR (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 63.9 bits (154), Expect = 8.0e-10 Identity = 35/69 (50.72%), Postives = 44/69 (63.77%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. TAIR10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 70.1 bits (170), Expect = 6.2e-13 Identity = 36/69 (52.17%), Postives = 47/69 (68.12%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 64.7 bits (156), Expect = 2.6e-11 Identity = 31/65 (47.69%), Postives = 46/65 (70.77%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. TAIR10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 64.3 bits (155), Expect = 3.4e-11 Identity = 31/65 (47.69%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of Cla97C05G085590.1 vs. TAIR10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 43.5 bits (101), Expect = 6.2e-05 Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
|