Cla97C05G085570.1 (mRNA) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTACAACATGCAAAGGTAAATGAGTAATATTGCATCATCAAGTCATCTTCGGTTTTTGAACATTGTATTTATTTTAATTTTATCATTTTTTCACAATAATTTTAAATTTTAATTTAAAAAACACAAACTATGCCTATTTAGATTTTGGATTTTTAACACTATATTTATAAACATTATTTTTATATATAGATTTTTTTTTTCATGTTATTCAACCTACACGAGCTTAAATTTATGAAAAAATGAATTAATATCGTTTTGCATGTTTCACTTTTAGGAAAGAGTTCATGGCCGGAATTGGTTGGTAAGGCAGGAAAAGAAGCAGAGAAAATTATTGAGAAGGAGAATCCATTGGTTGACGCCATTATTGTTGATGAAGGATCAATGGTGATTCTAGACTTCAGGTGCGATAGGGTCTGGGTTTGGGTTGATTCCAAAACAGGCATAGTCACTAGGACTCCTTTCATTGGTTAA ATGTCTACAACATGCAAAGGAAAGAGTTCATGGCCGGAATTGGTTGGTAAGGCAGGAAAAGAAGCAGAGAAAATTATTGAGAAGGAGAATCCATTGGTTGACGCCATTATTGTTGATGAAGGATCAATGGTGATTCTAGACTTCAGGTGCGATAGGGTCTGGGTTTGGGTTGATTCCAAAACAGGCATAGTCACTAGGACTCCTTTCATTGGTTAA ATGTCTACAACATGCAAAGGAAAGAGTTCATGGCCGGAATTGGTTGGTAAGGCAGGAAAAGAAGCAGAGAAAATTATTGAGAAGGAGAATCCATTGGTTGACGCCATTATTGTTGATGAAGGATCAATGGTGATTCTAGACTTCAGGTGCGATAGGGTCTGGGTTTGGGTTGATTCCAAAACAGGCATAGTCACTAGGACTCCTTTCATTGGTTAA MSTTCKGKSSWPELVGKAGKEAEKIIEKENPLVDAIIVDEGSMVILDFRCDRVWVWVDSKTGIVTRTPFIG
BLAST of Cla97C05G085570.1 vs. NCBI nr
Match: XP_004134090.1 (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus] >KGN56904.1 hypothetical protein Csa_3G142960 [Cucumis sativus]) HSP 1 Score: 138.3 bits (347), Expect = 1.0e-29 Identity = 65/71 (91.55%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. NCBI nr
Match: PNT15263.1 (hypothetical protein POPTR_010G075200v3 [Populus trichocarpa]) HSP 1 Score: 105.9 bits (263), Expect = 5.7e-20 Identity = 52/69 (75.36%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. NCBI nr
Match: NP_001238694.1 (putative protease inhibitor [Glycine max] >ACA23204.1 putative protease inhibitor [Glycine max] >KHN01082.1 Inhibitor of trypsin and hageman factor [Glycine soja] >KRH34453.1 hypothetical protein GLYMA_10G184700 [Glycine max]) HSP 1 Score: 105.9 bits (263), Expect = 5.7e-20 Identity = 52/71 (73.24%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. NCBI nr
Match: POE98891.1 (glu s.griseus protease inhibitor [Quercus suber]) HSP 1 Score: 105.5 bits (262), Expect = 7.4e-20 Identity = 51/71 (71.83%), Postives = 58/71 (81.69%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. NCBI nr
Match: XP_016898985.1 (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis melo]) HSP 1 Score: 105.1 bits (261), Expect = 9.7e-20 Identity = 50/71 (70.42%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. TrEMBL
Match: tr|A0A0A0L795|A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 6.8e-30 Identity = 65/71 (91.55%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. TrEMBL
Match: tr|B1ACD2|B1ACD2_SOYBN (Putative protease inhibitor OS=Glycine max OX=3847 GN=100170748 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 3.8e-20 Identity = 52/71 (73.24%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. TrEMBL
Match: tr|U5G1C3|U5G1C3_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_010G075200v3 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 3.8e-20 Identity = 52/69 (75.36%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. TrEMBL
Match: tr|A0A2P4L0Z7|A0A2P4L0Z7_QUESU (Glu s.griseus protease inhibitor OS=Quercus suber OX=58331 GN=CFP56_44653 PE=4 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 4.9e-20 Identity = 51/71 (71.83%), Postives = 58/71 (81.69%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. TrEMBL
Match: tr|A0A1S4DTF7|A0A1S4DTF7_CUCME (inhibitor of trypsin and hageman factor-like OS=Cucumis melo OX=3656 GN=LOC103483638 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 6.4e-20 Identity = 50/71 (70.42%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. Swiss-Prot
Match: sp|P24076|BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 6.4e-15 Identity = 40/67 (59.70%), Postives = 48/67 (71.64%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. Swiss-Prot
Match: sp|P19873|ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 5.4e-14 Identity = 37/69 (53.62%), Postives = 50/69 (72.46%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. Swiss-Prot
Match: sp|P80211|ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 9.2e-14 Identity = 39/64 (60.94%), Postives = 45/64 (70.31%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. Swiss-Prot
Match: sp|P82381|ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.7e-13 Identity = 37/69 (53.62%), Postives = 47/69 (68.12%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. Swiss-Prot
Match: sp|P86971|ITI_FAGTA (Trypsin inhibitor OS=Fagopyrum tataricum OX=62330 PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 5.2e-09 Identity = 33/72 (45.83%), Postives = 42/72 (58.33%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. TAIR10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 73.6 bits (179), Expect = 5.7e-14 Identity = 38/71 (53.52%), Postives = 47/71 (66.20%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 72.0 bits (175), Expect = 1.6e-13 Identity = 35/73 (47.95%), Postives = 54/73 (73.97%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. TAIR10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 54.7 bits (130), Expect = 2.7e-08 Identity = 31/64 (48.44%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. TAIR10
Match: AT5G43570.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 52.8 bits (125), Expect = 1.0e-07 Identity = 31/74 (41.89%), Postives = 41/74 (55.41%), Query Frame = 0
BLAST of Cla97C05G085570.1 vs. TAIR10
Match: AT3G50020.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 44.3 bits (103), Expect = 3.7e-05 Identity = 27/67 (40.30%), Postives = 37/67 (55.22%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
|