Cla97C03G056300.1 (mRNA) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTATCTCTCATCAAAGTCAAATGTCTTTAGCTTTGGTGTTCTAGTTTTAGGGATCATGATTGGGGCAAAAGAATAACCGAATTGGCTACCAATTAATGAGAATATAGAAGATCATCACTTAGCAATGTGAGTGCAACTTTTTTTTTTTTTCTTTCAGAAAAATGTCAATAACCTCTAAATTAGGAGTTTAATAATATGAATTGATTTGATTTATGTAGGCATGGAGAAACTGGAAGGAGGGAACACCATTGAATATTATAGATCCTTCTATTGAAATTCAAAGTGAGATAAGAGATGAAGTGACAAGATGCATCCATATCGGGTTACTTTGTGTTCAAGAAAAGGTAGGTGGTAGGCCAACAATGACTACTGTACTTCTCATGCTTAACAGTGATTTTGTTGATTTTCCAAGACCGTCTCCACCTTCATTCTGTATGAACACTAGAACCCAACCTAATTACTCTTAG ATGGCTATCTCTCATCAAAGTCAAATGTCTTTAGCTTTGGCATGGAGAAACTGGAAGGAGGGAACACCATTGAATATTATAGATCCTTCTATTGAAATTCAAAGTGAGATAAGAGATGAAGTGACAAGATGCATCCATATCGGGTTACTTTGTGTTCAAGAAAAGGTAGGTGGTAGGCCAACAATGACTACTGTACTTCTCATGCTTAACAGTGATTTTGTTGATTTTCCAAGACCGTCTCCACCTTCATTCTGTATGAACACTAGAACCCAACCTAATTACTCTTAG ATGGCTATCTCTCATCAAAGTCAAATGTCTTTAGCTTTGGCATGGAGAAACTGGAAGGAGGGAACACCATTGAATATTATAGATCCTTCTATTGAAATTCAAAGTGAGATAAGAGATGAAGTGACAAGATGCATCCATATCGGGTTACTTTGTGTTCAAGAAAAGGTAGGTGGTAGGCCAACAATGACTACTGTACTTCTCATGCTTAACAGTGATTTTGTTGATTTTCCAAGACCGTCTCCACCTTCATTCTGTATGAACACTAGAACCCAACCTAATTACTCTTAG MAISHQSQMSLALAWRNWKEGTPLNIIDPSIEIQSEIRDEVTRCIHIGLLCVQEKVGGRPTMTTVLLMLNSDFVDFPRPSPPSFCMNTRTQPNYS
BLAST of Cla97C03G056300.1 vs. NCBI nr
Match: XP_016898896.1 (PREDICTED: cysteine-rich receptor-like protein kinase 28 [Cucumis melo]) HSP 1 Score: 132.5 bits (332), Expect = 7.6e-28 Identity = 59/85 (69.41%), Postives = 69/85 (81.18%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. NCBI nr
Match: KGN64573.1 (hypothetical protein Csa_1G065930 [Cucumis sativus]) HSP 1 Score: 129.4 bits (324), Expect = 6.4e-27 Identity = 58/85 (68.24%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. NCBI nr
Match: XP_011648430.1 (PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein kinase 29 [Cucumis sativus]) HSP 1 Score: 128.3 bits (321), Expect = 1.4e-26 Identity = 57/83 (68.67%), Postives = 65/83 (78.31%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. NCBI nr
Match: XP_022927525.1 (cysteine-rich receptor-like protein kinase 29 [Cucurbita moschata]) HSP 1 Score: 119.0 bits (297), Expect = 8.7e-24 Identity = 54/84 (64.29%), Postives = 67/84 (79.76%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. NCBI nr
Match: XP_023001237.1 (cysteine-rich receptor-like protein kinase 29 [Cucurbita maxima]) HSP 1 Score: 119.0 bits (297), Expect = 8.7e-24 Identity = 54/84 (64.29%), Postives = 67/84 (79.76%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. TrEMBL
Match: tr|A0A1S4DSD0|A0A1S4DSD0_CUCME (cysteine-rich receptor-like protein kinase 28 OS=Cucumis melo OX=3656 GN=LOC103489199 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 5.0e-28 Identity = 59/85 (69.41%), Postives = 69/85 (81.18%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. TrEMBL
Match: tr|A0A0A0LS47|A0A0A0LS47_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G065930 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 4.2e-27 Identity = 58/85 (68.24%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. TrEMBL
Match: tr|A0A1S4DSC0|A0A1S4DSC0_CUCME (uncharacterized protein LOC103489206 OS=Cucumis melo OX=3656 GN=LOC103489206 PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 3.7e-23 Identity = 54/77 (70.13%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. TrEMBL
Match: tr|A0A1S4DS88|A0A1S4DS88_CUCME (cysteine-rich receptor-like protein kinase 26 isoform X3 OS=Cucumis melo OX=3656 GN=LOC103489186 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 5.0e-20 Identity = 54/80 (67.50%), Postives = 62/80 (77.50%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. TrEMBL
Match: tr|A0A1S4DS67|A0A1S4DS67_CUCME (cysteine-rich receptor-like protein kinase 26 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103489186 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 5.0e-20 Identity = 54/80 (67.50%), Postives = 62/80 (77.50%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. Swiss-Prot
Match: sp|O23081|CRK41_ARATH (Cysteine-rich receptor-like protein kinase 41 OS=Arabidopsis thaliana OX=3702 GN=CRK41 PE=3 SV=2) HSP 1 Score: 90.5 bits (223), Expect = 1.1e-17 Identity = 38/74 (51.35%), Postives = 53/74 (71.62%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. Swiss-Prot
Match: sp|O23082|Y4960_ARATH (Putative receptor-like protein kinase At4g00960 OS=Arabidopsis thaliana OX=3702 GN=At4g00960 PE=3 SV=2) HSP 1 Score: 87.0 bits (214), Expect = 1.2e-16 Identity = 37/74 (50.00%), Postives = 51/74 (68.92%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. Swiss-Prot
Match: sp|Q8S9L6|CRK29_ARATH (Cysteine-rich receptor-like protein kinase 29 OS=Arabidopsis thaliana OX=3702 GN=CRK29 PE=2 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 3.5e-16 Identity = 42/83 (50.60%), Postives = 54/83 (65.06%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. Swiss-Prot
Match: sp|O81905|SD18_ARATH (Receptor-like serine/threonine-protein kinase SD1-8 OS=Arabidopsis thaliana OX=3702 GN=SD18 PE=1 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 4.5e-16 Identity = 40/78 (51.28%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. Swiss-Prot
Match: sp|O65405|CRK28_ARATH (Cysteine-rich receptor-like protein kinase 28 OS=Arabidopsis thaliana OX=3702 GN=CRK28 PE=3 SV=2) HSP 1 Score: 82.0 bits (201), Expect = 3.8e-15 Identity = 40/83 (48.19%), Postives = 53/83 (63.86%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. TAIR10
Match: AT4G00970.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 41) HSP 1 Score: 90.5 bits (223), Expect = 6.0e-19 Identity = 38/74 (51.35%), Postives = 53/74 (71.62%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. TAIR10
Match: AT4G00960.1 (Protein kinase superfamily protein) HSP 1 Score: 87.0 bits (214), Expect = 6.6e-18 Identity = 37/74 (50.00%), Postives = 51/74 (68.92%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. TAIR10
Match: AT4G21410.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 29) HSP 1 Score: 85.5 bits (210), Expect = 1.9e-17 Identity = 42/83 (50.60%), Postives = 54/83 (65.06%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. TAIR10
Match: AT4G21380.1 (receptor kinase 3) HSP 1 Score: 85.1 bits (209), Expect = 2.5e-17 Identity = 40/78 (51.28%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of Cla97C03G056300.1 vs. TAIR10
Match: AT4G21400.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 28) HSP 1 Score: 82.0 bits (201), Expect = 2.1e-16 Identity = 40/83 (48.19%), Postives = 53/83 (63.86%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
|