Cla000524.1 (mRNA) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAAGGGAAGGCAAGGAGAAAGAGTCAAACTCTACATTAGAGGAATGGTCCTTAGGTACAAGAGGTCAAAGTCAAACCAGTATCCAAGAACATCACTAATCCAAATTGGAGGGGTGAACACCAGGGAAGAGGTCGCATGGTACGTTGGAAAGTGCTTGGCGTTCACAAGAAGCAAAATGAAACTCACTACAGATGCATTTGGGGCAAGGTTTGCAAGCTTCATGGTAACAGTGGCAATATTCGAGCTAAGTTCAAGTCAAACTTTTGCCCCCAAAGTCCATGGGTGA ATGGTGAAGGGAAGGCAAGGAGAAAGAGTCAAACTCTACATTAGAGGAATGGTCCTTAGGTACAAGAGGTCAAAGTCAAACCAGTATCCAAGAACATCACTAATCCAAATTGGAGGGGTGAACACCAGGGAAGAGGTCGCATGGTACGTTGGAAAGTGCTTGGCGTTCACAAGAAGCAAAATGAAACTCACTACAGATGCATTTGGGGCAAGGTTTGCAAGCTTCATGGTAACAGTGGCAATATTCGAGCTAAGTTCAAGTCAAACTTTTGCCCCCAAAGTCCATGGGTGA ATGGTGAAGGGAAGGCAAGGAGAAAGAGTCAAACTCTACATTAGAGGAATGGTCCTTAGGTACAAGAGGTCAAAGTCAAACCAGTATCCAAGAACATCACTAATCCAAATTGGAGGGGTGAACACCAGGGAAGAGGTCGCATGGTACGTTGGAAAGTGCTTGGCGTTCACAAGAAGCAAAATGAAACTCACTACAGATGCATTTGGGGCAAGGTTTGCAAGCTTCATGGTAACAGTGGCAATATTCGAGCTAAGTTCAAGTCAAACTTTTGCCCCCAAAGTCCATGGGTGA MVKGRQGERVKLYIRGMVLRYKRSKSNQYPRTSLIQIGGVNTREEVAWYVGKCLAFTRSKMKLTTDAFGARFASFMVTVAIFELSSSQTFAPKVHG
BLAST of Cla000524 vs. Swiss-Prot
Match: R35A1_ARATH (60S ribosomal protein L35a-1 OS=Arabidopsis thaliana GN=RPL35AA PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 4.8e-18 Identity = 41/56 (73.21%), Postives = 47/56 (83.93%), Query Frame = 1
BLAST of Cla000524 vs. Swiss-Prot
Match: R35A3_ARATH (60S ribosomal protein L35a-3 OS=Arabidopsis thaliana GN=RPL35AC PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 4.8e-18 Identity = 42/56 (75.00%), Postives = 47/56 (83.93%), Query Frame = 1
BLAST of Cla000524 vs. Swiss-Prot
Match: R35A2_ARATH (60S ribosomal protein L35a-2 OS=Arabidopsis thaliana GN=RPL35AB PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.4e-17 Identity = 43/55 (78.18%), Postives = 46/55 (83.64%), Query Frame = 1
BLAST of Cla000524 vs. Swiss-Prot
Match: R35A4_ARATH (60S ribosomal protein L35a-4 OS=Arabidopsis thaliana GN=RPL35AD PE=3 SV=2) HSP 1 Score: 89.7 bits (221), Expect = 1.8e-17 Identity = 42/55 (76.36%), Postives = 46/55 (83.64%), Query Frame = 1
BLAST of Cla000524 vs. Swiss-Prot
Match: RL35A_DICDI (60S ribosomal protein L35a OS=Dictyostelium discoideum GN=rpl35a PE=3 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 7.2e-06 Identity = 26/52 (50.00%), Postives = 35/52 (67.31%), Query Frame = 1
BLAST of Cla000524 vs. TrEMBL
Match: A0A022QFA1_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a016658mg PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.3e-17 Identity = 48/63 (76.19%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of Cla000524 vs. TrEMBL
Match: A0A022RPU6_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a015450mg PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.2e-17 Identity = 47/63 (74.60%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of Cla000524 vs. TrEMBL
Match: A0A068V006_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00039165001 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.2e-17 Identity = 46/63 (73.02%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of Cla000524 vs. TrEMBL
Match: A9PB30_POPTR (Ribosomal protein L33 OS=Populus trichocarpa GN=POPTR_0008s06370g PE=2 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.2e-17 Identity = 47/63 (74.60%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of Cla000524 vs. TrEMBL
Match: A0A067LKI6_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_01339 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.2e-17 Identity = 47/63 (74.60%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of Cla000524 vs. TAIR10
Match: AT1G07070.1 (AT1G07070.1 Ribosomal protein L35Ae family protein) HSP 1 Score: 91.7 bits (226), Expect = 2.7e-19 Identity = 41/56 (73.21%), Postives = 47/56 (83.93%), Query Frame = 1
BLAST of Cla000524 vs. TAIR10
Match: AT1G74270.1 (AT1G74270.1 Ribosomal protein L35Ae family protein) HSP 1 Score: 91.7 bits (226), Expect = 2.7e-19 Identity = 42/56 (75.00%), Postives = 47/56 (83.93%), Query Frame = 1
BLAST of Cla000524 vs. TAIR10
Match: AT1G41880.1 (AT1G41880.1 Ribosomal protein L35Ae family protein) HSP 1 Score: 90.1 bits (222), Expect = 7.9e-19 Identity = 43/55 (78.18%), Postives = 46/55 (83.64%), Query Frame = 1
BLAST of Cla000524 vs. TAIR10
Match: AT3G55750.1 (AT3G55750.1 Ribosomal protein L35Ae family protein) HSP 1 Score: 89.7 bits (221), Expect = 1.0e-18 Identity = 42/55 (76.36%), Postives = 46/55 (83.64%), Query Frame = 1
BLAST of Cla000524 vs. NCBI nr
Match: gi|778695048|ref|XP_011653915.1| (PREDICTED: 60S ribosomal protein L35a-1-like [Cucumis sativus]) HSP 1 Score: 99.8 bits (247), Expect = 2.8e-18 Identity = 49/63 (77.78%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of Cla000524 vs. NCBI nr
Match: gi|659083091|ref|XP_008442180.1| (PREDICTED: 60S ribosomal protein L35a-1-like [Cucumis melo]) HSP 1 Score: 97.4 bits (241), Expect = 1.4e-17 Identity = 48/63 (76.19%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of Cla000524 vs. NCBI nr
Match: gi|848900481|ref|XP_012850403.1| (PREDICTED: 60S ribosomal protein L35a-3-like [Erythranthe guttata]) HSP 1 Score: 97.1 bits (240), Expect = 1.8e-17 Identity = 48/63 (76.19%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of Cla000524 vs. NCBI nr
Match: gi|694320386|ref|XP_009351088.1| (PREDICTED: 60S ribosomal protein L35a-1 [Pyrus x bretschneideri]) HSP 1 Score: 96.7 bits (239), Expect = 2.4e-17 Identity = 47/63 (74.60%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of Cla000524 vs. NCBI nr
Match: gi|502112306|ref|XP_004494288.1| (PREDICTED: 60S ribosomal protein L35a-1-like [Cicer arietinum]) HSP 1 Score: 96.7 bits (239), Expect = 2.4e-17 Identity = 47/63 (74.60%), Postives = 55/63 (87.30%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
|