Carg23358-RA (mRNA) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTGCTGCCAATCTCTTTGCTCCGCCCATGGCTTCCGTCCATGTCGCCACCGGATCGCGTCGCTCCTCTGCTAGTTTCTACGACATCCTCCGCGTCAAGAACAACGCTTCCTCTGTTGAAATCAAGACTGCCTACCGGAGTTTAGCGAAGATTTACCATCCGGACTCGGCGAGGAAATCGGACTGCGATTCCTTTTCTTCTGATGATGGATGCAGTTTCCTTGAGATTCACAATGCGTACGAGACGCTTTCGGACCCTGCTACTCGGGCTCATTACGATCTTGCTTTGGCTGCTCTCACTAGACGGGCGTTTCTTCGATCGCGGTCTAGGCCGCATCGGCGGTGGGAAACGGATCAGTGTTGGTAG ATGTCTGCTGCCAATCTCTTTGCTCCGCCCATGGCTTCCGTCCATGTCGCCACCGGATCGCGTCGCTCCTCTGCTAGTTTCTACGACATCCTCCGCGTCAAGAACAACGCTTCCTCTGTTGAAATCAAGACTGCCTACCGGAGTTTAGCGAAGATTTACCATCCGGACTCGGCGAGGAAATCGGACTGCGATTCCTTTTCTTCTGATGATGGATGCAGTTTCCTTGAGATTCACAATGCGTACGAGACGCTTTCGGACCCTGCTACTCGGGCTCATTACGATCTTGCTTTGGCTGCTCTCACTAGACGGGCGTTTCTTCGATCGCGGTCTAGGCCGCATCGGCGGTGGGAAACGGATCAGTGTTGGTAG ATGTCTGCTGCCAATCTCTTTGCTCCGCCCATGGCTTCCGTCCATGTCGCCACCGGATCGCGTCGCTCCTCTGCTAGTTTCTACGACATCCTCCGCGTCAAGAACAACGCTTCCTCTGTTGAAATCAAGACTGCCTACCGGAGTTTAGCGAAGATTTACCATCCGGACTCGGCGAGGAAATCGGACTGCGATTCCTTTTCTTCTGATGATGGATGCAGTTTCCTTGAGATTCACAATGCGTACGAGACGCTTTCGGACCCTGCTACTCGGGCTCATTACGATCTTGCTTTGGCTGCTCTCACTAGACGGGCGTTTCTTCGATCGCGGTCTAGGCCGCATCGGCGGTGGGAAACGGATCAGTGTTGGTAG MSAANLFAPPMASVHVATGSRRSSASFYDILRVKNNASSVEIKTAYRSLAKIYHPDSARKSDCDSFSSDDGCSFLEIHNAYETLSDPATRAHYDLALAALTRRAFLRSRSRPHRRWETDQCW
BLAST of Carg23358-RA vs. NCBI nr
Match: XP_022940753.1 (chaperone protein dnaJ 11, chloroplastic-like [Cucurbita moschata]) HSP 1 Score: 245.0 bits (624), Expect = 1.3e-61 Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = 0
BLAST of Carg23358-RA vs. NCBI nr
Match: XP_023525212.1 (chaperone protein dnaJ 11, chloroplastic-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 243.8 bits (621), Expect = 3.0e-61 Identity = 121/122 (99.18%), Postives = 122/122 (100.00%), Query Frame = 0
BLAST of Carg23358-RA vs. NCBI nr
Match: XP_022981701.1 (chaperone protein dnaJ 11, chloroplastic-like [Cucurbita maxima]) HSP 1 Score: 235.7 bits (600), Expect = 8.2e-59 Identity = 116/122 (95.08%), Postives = 120/122 (98.36%), Query Frame = 0
BLAST of Carg23358-RA vs. NCBI nr
Match: XP_023536215.1 (chaperone protein dnaJ 11, chloroplastic-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 207.6 bits (527), Expect = 2.4e-50 Identity = 103/126 (81.75%), Postives = 111/126 (88.10%), Query Frame = 0
BLAST of Carg23358-RA vs. NCBI nr
Match: XP_022936967.1 (chaperone protein dnaJ 11, chloroplastic-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 202.6 bits (514), Expect = 7.7e-49 Identity = 102/126 (80.95%), Postives = 111/126 (88.10%), Query Frame = 0
BLAST of Carg23358-RA vs. TAIR10
Match: AT3G13310.1 (Chaperone DnaJ-domain superfamily protein) HSP 1 Score: 97.4 bits (241), Expect = 6.3e-21 Identity = 55/113 (48.67%), Postives = 64/113 (56.64%), Query Frame = 0
BLAST of Carg23358-RA vs. TAIR10
Match: AT4G36040.1 (Chaperone DnaJ-domain superfamily protein) HSP 1 Score: 77.0 bits (188), Expect = 8.8e-15 Identity = 50/108 (46.30%), Postives = 60/108 (55.56%), Query Frame = 0
BLAST of Carg23358-RA vs. TAIR10
Match: AT2G17880.1 (Chaperone DnaJ-domain superfamily protein) HSP 1 Score: 74.3 bits (181), Expect = 5.7e-14 Identity = 49/93 (52.69%), Postives = 57/93 (61.29%), Query Frame = 0
BLAST of Carg23358-RA vs. TAIR10
Match: AT4G39960.1 (Molecular chaperone Hsp40/DnaJ family protein) HSP 1 Score: 60.5 bits (145), Expect = 8.5e-10 Identity = 35/85 (41.18%), Postives = 46/85 (54.12%), Query Frame = 0
BLAST of Carg23358-RA vs. TAIR10
Match: AT2G22360.1 (DNAJ heat shock family protein) HSP 1 Score: 58.5 bits (140), Expect = 3.2e-09 Identity = 34/79 (43.04%), Postives = 44/79 (55.70%), Query Frame = 0
BLAST of Carg23358-RA vs. Swiss-Prot
Match: sp|Q9FYB5|DNJ11_ARATH (Chaperone protein dnaJ 11, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATJ11 PE=1 SV=2) HSP 1 Score: 77.0 bits (188), Expect = 1.6e-13 Identity = 50/108 (46.30%), Postives = 60/108 (55.56%), Query Frame = 0
BLAST of Carg23358-RA vs. Swiss-Prot
Match: sp|Q9KD71|DNAJ_BACHD (Chaperone protein DnaJ OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=dnaJ PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.4e-09 Identity = 31/72 (43.06%), Postives = 43/72 (59.72%), Query Frame = 0
BLAST of Carg23358-RA vs. Swiss-Prot
Match: sp|O66921|DNAJ2_AQUAE (Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=dnaJ2 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 3.1e-09 Identity = 32/69 (46.38%), Postives = 41/69 (59.42%), Query Frame = 0
BLAST of Carg23358-RA vs. Swiss-Prot
Match: sp|Q5WHG0|DNAJ_BACSK (Chaperone protein DnaJ OS=Bacillus clausii (strain KSM-K16) OX=66692 GN=dnaJ PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 4.0e-09 Identity = 31/72 (43.06%), Postives = 43/72 (59.72%), Query Frame = 0
BLAST of Carg23358-RA vs. Swiss-Prot
Match: sp|P17631|DNAJ_BACSU (Chaperone protein DnaJ OS=Bacillus subtilis (strain 168) OX=224308 GN=dnaJ PE=2 SV=3) HSP 1 Score: 62.4 bits (150), Expect = 4.0e-09 Identity = 33/72 (45.83%), Postives = 42/72 (58.33%), Query Frame = 0
BLAST of Carg23358-RA vs. TrEMBL
Match: tr|A0A0A0K365|A0A0A0K365_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G190690 PE=4 SV=1) HSP 1 Score: 182.2 bits (461), Expect = 7.1e-43 Identity = 97/125 (77.60%), Postives = 104/125 (83.20%), Query Frame = 0
BLAST of Carg23358-RA vs. TrEMBL
Match: tr|A0A218XLQ7|A0A218XLQ7_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CDL15_Pgr012177 PE=4 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 4.3e-24 Identity = 61/119 (51.26%), Postives = 80/119 (67.23%), Query Frame = 0
BLAST of Carg23358-RA vs. TrEMBL
Match: tr|A0A2R6P576|A0A2R6P576_ACTCH (Chaperone protein dnaJ 11 like OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc33424 PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 1.1e-22 Identity = 66/109 (60.55%), Postives = 79/109 (72.48%), Query Frame = 0
BLAST of Carg23358-RA vs. TrEMBL
Match: tr|B9SXA3|B9SXA3_RICCO (Chaperone protein DNAj, putative OS=Ricinus communis OX=3988 GN=RCOM_0267960 PE=4 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.8e-22 Identity = 64/111 (57.66%), Postives = 76/111 (68.47%), Query Frame = 0
BLAST of Carg23358-RA vs. TrEMBL
Match: tr|A0A2P5BEL0|A0A2P5BEL0_PARAD (Terminal organelle assembly protein OS=Parasponia andersonii OX=3476 GN=PanWU01x14_246130 PE=4 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.8e-22 Identity = 59/103 (57.28%), Postives = 73/103 (70.87%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
|