Carg16721-RA (mRNA) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGGTTTTGGAAGTTCAAAGAACGATAACGACGCACCTCTCTGTGCCAACAACTGTGGCTTTTATGGCTCTCCGAAGAATCGAAACCTGTGCTCCTTCTGTTACGCCGCTTTCCTCAAAGAAACCGGCGAAAATTCAGAACGACTAGAGAACTCAAACCATCGAATACGTGAGGAAGAACCAAATCTCCGGAAAAGACGATTTCCTTGGGCCGGACAGAGTTCCGAAACATCTGAACCGGTCGCCGATTTGAATAATCCGGCCAATAAAACCAAAATTAGATGCAAAATCTGCAAGAAGAAGATCGGAATGTTAGGATTCAATTGCCGGTGTGGAGGTCCATTCTGCTGCAAACATAGGCATCCTGAAGAGCATTCGTGCGACGTCGACCACAAGGCAATCGGCCGGCAGATTCTGGCGAAGCACATTGTCGAATGCAAGGCCGATAAATTGGAGTTTAGGGTTTAG ATGGCGGGTTTTGGAAGTTCAAAGAACGATAACGACGCACCTCTCTGTGCCAACAACTGTGGCTTTTATGGCTCTCCGAAGAATCGAAACCTGTGCTCCTTCTGTTACGCCGCTTTCCTCAAAGAAACCGGCGAAAATTCAGAACGACTAGAGAACTCAAACCATCGAATACGTGAGGAAGAACCAAATCTCCGGAAAAGACGATTTCCTTGGGCCGGACAGAGTTCCGAAACATCTGAACCGGTCGCCGATTTGAATAATCCGGCCAATAAAACCAAAATTAGATGCAAAATCTGCAAGAAGAAGATCGGAATGTTAGGATTCAATTGCCGGTGTGGAGGTCCATTCTGCTGCAAACATAGGCATCCTGAAGAGCATTCGTGCGACGTCGACCACAAGGCAATCGGCCGGCAGATTCTGGCGAAGCACATTGTCGAATGCAAGGCCGATAAATTGGAGTTTAGGGTTTAG ATGGCGGGTTTTGGAAGTTCAAAGAACGATAACGACGCACCTCTCTGTGCCAACAACTGTGGCTTTTATGGCTCTCCGAAGAATCGAAACCTGTGCTCCTTCTGTTACGCCGCTTTCCTCAAAGAAACCGGCGAAAATTCAGAACGACTAGAGAACTCAAACCATCGAATACGTGAGGAAGAACCAAATCTCCGGAAAAGACGATTTCCTTGGGCCGGACAGAGTTCCGAAACATCTGAACCGGTCGCCGATTTGAATAATCCGGCCAATAAAACCAAAATTAGATGCAAAATCTGCAAGAAGAAGATCGGAATGTTAGGATTCAATTGCCGGTGTGGAGGTCCATTCTGCTGCAAACATAGGCATCCTGAAGAGCATTCGTGCGACGTCGACCACAAGGCAATCGGCCGGCAGATTCTGGCGAAGCACATTGTCGAATGCAAGGCCGATAAATTGGAGTTTAGGGTTTAG MAGFGSSKNDNDAPLCANNCGFYGSPKNRNLCSFCYAAFLKETGENSERLENSNHRIREEEPNLRKRRFPWAGQSSETSEPVADLNNPANKTKIRCKICKKKIGMLGFNCRCGGPFCCKHRHPEEHSCDVDHKAIGRQILAKHIVECKADKLEFRV
BLAST of Carg16721-RA vs. NCBI nr
Match: KGN57297.1 (hypothetical protein Csa_3G177900 [Cucumis sativus]) HSP 1 Score: 184.5 bits (467), Expect = 2.8e-43 Identity = 93/157 (59.24%), Postives = 108/157 (68.79%), Query Frame = 0
BLAST of Carg16721-RA vs. NCBI nr
Match: KGN57296.1 (hypothetical protein Csa_3G177400 [Cucumis sativus]) HSP 1 Score: 183.0 bits (463), Expect = 8.0e-43 Identity = 95/158 (60.13%), Postives = 115/158 (72.78%), Query Frame = 0
BLAST of Carg16721-RA vs. NCBI nr
Match: XP_008439392.1 (PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 10-like [Cucumis melo]) HSP 1 Score: 170.6 bits (431), Expect = 4.1e-39 Identity = 89/146 (60.96%), Postives = 109/146 (74.66%), Query Frame = 0
BLAST of Carg16721-RA vs. NCBI nr
Match: XP_022141121.1 (zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Momordica charantia]) HSP 1 Score: 169.9 bits (429), Expect = 7.0e-39 Identity = 90/167 (53.89%), Postives = 101/167 (60.48%), Query Frame = 0
BLAST of Carg16721-RA vs. NCBI nr
Match: XP_008439393.1 (PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 10-like [Cucumis melo]) HSP 1 Score: 164.9 bits (416), Expect = 2.3e-37 Identity = 85/145 (58.62%), Postives = 103/145 (71.03%), Query Frame = 0
BLAST of Carg16721-RA vs. TAIR10
Match: AT4G25380.1 (stress-associated protein 10) HSP 1 Score: 99.8 bits (247), Expect = 1.6e-21 Identity = 59/145 (40.69%), Postives = 74/145 (51.03%), Query Frame = 0
BLAST of Carg16721-RA vs. TAIR10
Match: AT1G12440.1 (A20/AN1-like zinc finger family protein) HSP 1 Score: 97.8 bits (242), Expect = 6.2e-21 Identity = 57/165 (34.55%), Postives = 80/165 (48.48%), Query Frame = 0
BLAST of Carg16721-RA vs. TAIR10
Match: AT4G22820.1 (A20/AN1-like zinc finger family protein) HSP 1 Score: 94.4 bits (233), Expect = 6.8e-20 Identity = 53/173 (30.64%), Postives = 77/173 (44.51%), Query Frame = 0
BLAST of Carg16721-RA vs. TAIR10
Match: AT4G12040.1 (A20/AN1-like zinc finger family protein) HSP 1 Score: 94.4 bits (233), Expect = 6.8e-20 Identity = 60/176 (34.09%), Postives = 86/176 (48.86%), Query Frame = 0
BLAST of Carg16721-RA vs. TAIR10
Match: AT2G36320.1 (A20/AN1-like zinc finger family protein) HSP 1 Score: 87.8 bits (216), Expect = 6.4e-18 Identity = 54/146 (36.99%), Postives = 74/146 (50.68%), Query Frame = 0
BLAST of Carg16721-RA vs. Swiss-Prot
Match: sp|Q9STJ9|SAP10_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 10 OS=Arabidopsis thaliana OX=3702 GN=SAP10 PE=1 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.9e-20 Identity = 59/145 (40.69%), Postives = 74/145 (51.03%), Query Frame = 0
BLAST of Carg16721-RA vs. Swiss-Prot
Match: sp|Q6NNI8|SAP1_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 1 OS=Arabidopsis thaliana OX=3702 GN=SAP1 PE=1 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 1.1e-19 Identity = 57/165 (34.55%), Postives = 80/165 (48.48%), Query Frame = 0
BLAST of Carg16721-RA vs. Swiss-Prot
Match: sp|Q7Y1W9|SAP9_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 9 OS=Oryza sativa subsp. japonica OX=39947 GN=SAP9 PE=2 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 7.2e-19 Identity = 57/155 (36.77%), Postives = 71/155 (45.81%), Query Frame = 0
BLAST of Carg16721-RA vs. Swiss-Prot
Match: sp|Q9SZ69|SAP7_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 7 OS=Arabidopsis thaliana OX=3702 GN=SAP7 PE=1 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.2e-18 Identity = 60/176 (34.09%), Postives = 86/176 (48.86%), Query Frame = 0
BLAST of Carg16721-RA vs. Swiss-Prot
Match: sp|O49663|SAP9_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 9 OS=Arabidopsis thaliana OX=3702 GN=SAP9 PE=2 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.2e-18 Identity = 53/173 (30.64%), Postives = 77/173 (44.51%), Query Frame = 0
BLAST of Carg16721-RA vs. TrEMBL
Match: tr|A0A0A0L9J1|A0A0A0L9J1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G177900 PE=4 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 1.8e-43 Identity = 93/157 (59.24%), Postives = 108/157 (68.79%), Query Frame = 0
BLAST of Carg16721-RA vs. TrEMBL
Match: tr|A0A0A0LB47|A0A0A0LB47_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G177400 PE=4 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 5.3e-43 Identity = 95/158 (60.13%), Postives = 115/158 (72.78%), Query Frame = 0
BLAST of Carg16721-RA vs. TrEMBL
Match: tr|A0A1S3AZB4|A0A1S3AZB4_CUCME (zinc finger A20 and AN1 domain-containing stress-associated protein 10-like OS=Cucumis melo OX=3656 GN=LOC103484207 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 2.7e-39 Identity = 89/146 (60.96%), Postives = 109/146 (74.66%), Query Frame = 0
BLAST of Carg16721-RA vs. TrEMBL
Match: tr|A0A1S3AZB6|A0A1S3AZB6_CUCME (zinc finger A20 and AN1 domain-containing stress-associated protein 10-like OS=Cucumis melo OX=3656 GN=LOC103484208 PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 1.5e-37 Identity = 85/145 (58.62%), Postives = 103/145 (71.03%), Query Frame = 0
BLAST of Carg16721-RA vs. TrEMBL
Match: tr|A0A1S3ZRB5|A0A1S3ZRB5_TOBAC (putative zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Nicotiana tabacum OX=4097 GN=LOC107789534 PE=4 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 2.0e-26 Identity = 69/151 (45.70%), Postives = 84/151 (55.63%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
|