Carg14818-RA (mRNA) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGTTGGATTACTAATCCATGTCCTTAGAAAAGTGTCGGCGGGAGACCGGTTCGTAAGTTAAGGACTCTGGCCTACCAAAGGTGATTTTCCTCTCAGATTAAAGGTGCAATTGATTTTTTTTTTTTTTTTTTCCCTTCATCTAATTGCAATTTCCACTTTCTATTCTTCGTCTTCATTTCCAATCACCTCAGTAACAAAAGTGTAGTTGAATTTGGATGTTTTTAGATTGATGAATTTGAAGGTTAAAAGTTTTCACAGTTGAGCGGCAAGCAAATAGGGATTAGTTGGATTGGGAAAAATAGGCTCTGAAGTTGCCAAAAGGCTGGAGGGTTTTGGGTGCAGAATCTCATATAACTCAAGGACCAAGAAGCCAGTAGTTCCATACTCATTAACAGGGAGGTGA ATGGCGGTTGGATTACTAATCCATGTCCTTAGAAAAGTGTCGGCGGGAGACCGATTGATGAATTTGAAGGGATTAGTTGGATTGGGAAAAATAGGCTCTGAAGTTGCCAAAAGGCTGGAGGGTTTTGGGTGCAGAATCTCATATAACTCAAGGACCAAGAAGCCAGTAGTTCCATACTCATTAACAGGGAGGTGA ATGGCGGTTGGATTACTAATCCATGTCCTTAGAAAAGTGTCGGCGGGAGACCGATTGATGAATTTGAAGGGATTAGTTGGATTGGGAAAAATAGGCTCTGAAGTTGCCAAAAGGCTGGAGGGTTTTGGGTGCAGAATCTCATATAACTCAAGGACCAAGAAGCCAGTAGTTCCATACTCATTAACAGGGAGGTGA MAVGLLIHVLRKVSAGDRLMNLKGLVGLGKIGSEVAKRLEGFGCRISYNSRTKKPVVPYSLTGR
BLAST of Carg14818-RA vs. NCBI nr
Match: XP_004134341.2 (PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Cucumis sativus] >KGN56573.1 hypothetical protein Csa_3G124920 [Cucumis sativus]) HSP 1 Score: 91.7 bits (226), Expect = 1.0e-15 Identity = 53/79 (67.09%), Postives = 56/79 (70.89%), Query Frame = 0
BLAST of Carg14818-RA vs. NCBI nr
Match: XP_022147257.1 (glyoxylate/hydroxypyruvate reductase HPR3-like [Momordica charantia]) HSP 1 Score: 91.7 bits (226), Expect = 1.0e-15 Identity = 53/79 (67.09%), Postives = 56/79 (70.89%), Query Frame = 0
BLAST of Carg14818-RA vs. NCBI nr
Match: XP_023539897.1 (glyoxylate/hydroxypyruvate reductase HPR3-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 91.7 bits (226), Expect = 1.0e-15 Identity = 51/79 (64.56%), Postives = 55/79 (69.62%), Query Frame = 0
BLAST of Carg14818-RA vs. NCBI nr
Match: XP_004134340.1 (PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3 [Cucumis sativus] >KGN56571.1 hypothetical protein Csa_3G124900 [Cucumis sativus]) HSP 1 Score: 90.9 bits (224), Expect = 1.7e-15 Identity = 51/79 (64.56%), Postives = 55/79 (69.62%), Query Frame = 0
BLAST of Carg14818-RA vs. NCBI nr
Match: XP_008438122.1 (PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Cucumis melo]) HSP 1 Score: 90.9 bits (224), Expect = 1.7e-15 Identity = 52/79 (65.82%), Postives = 56/79 (70.89%), Query Frame = 0
BLAST of Carg14818-RA vs. TAIR10
Match: AT1G12550.1 (D-isomer specific 2-hydroxyacid dehydrogenase family protein) HSP 1 Score: 63.2 bits (152), Expect = 6.9e-11 Identity = 38/77 (49.35%), Postives = 44/77 (57.14%), Query Frame = 0
BLAST of Carg14818-RA vs. TAIR10
Match: AT2G45630.2 (D-isomer specific 2-hydroxyacid dehydrogenase family protein) HSP 1 Score: 62.4 bits (150), Expect = 1.2e-10 Identity = 36/78 (46.15%), Postives = 47/78 (60.26%), Query Frame = 0
BLAST of Carg14818-RA vs. TAIR10
Match: AT5G28310.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 53.5 bits (127), Expect = 5.5e-08 Identity = 25/37 (67.57%), Postives = 31/37 (83.78%), Query Frame = 0
BLAST of Carg14818-RA vs. TAIR10
Match: AT1G79870.1 (D-isomer specific 2-hydroxyacid dehydrogenase family protein) HSP 1 Score: 50.1 bits (118), Expect = 6.0e-07 Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 0
BLAST of Carg14818-RA vs. Swiss-Prot
Match: sp|Q9LE33|HPR3_ARATH (Glyoxylate/hydroxypyruvate reductase HPR3 OS=Arabidopsis thaliana OX=3702 GN=HPR3 PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.2e-09 Identity = 38/77 (49.35%), Postives = 44/77 (57.14%), Query Frame = 0
BLAST of Carg14818-RA vs. Swiss-Prot
Match: sp|Q65CJ7|HPPR_PLESU (Hydroxyphenylpyruvate reductase OS=Plectranthus scutellarioides OX=4142 GN=HPPR PE=1 SV=2) HSP 1 Score: 50.8 bits (120), Expect = 6.4e-06 Identity = 31/81 (38.27%), Postives = 44/81 (54.32%), Query Frame = 0
BLAST of Carg14818-RA vs. Swiss-Prot
Match: sp|B6YWH0|GYAR_THEON (Glyoxylate reductase OS=Thermococcus onnurineus (strain NA1) OX=523850 GN=gyaR PE=3 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.1e-05 Identity = 22/38 (57.89%), Postives = 28/38 (73.68%), Query Frame = 0
BLAST of Carg14818-RA vs. Swiss-Prot
Match: sp|Q9CA90|HPR2_ARATH (Glyoxylate/hydroxypyruvate reductase A HPR2 OS=Arabidopsis thaliana OX=3702 GN=HPR2 PE=1 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.1e-05 Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 0
BLAST of Carg14818-RA vs. Swiss-Prot
Match: sp|C5A1V0|GYAR_THEGJ (Glyoxylate reductase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) OX=593117 GN=gyaR PE=3 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 2.7e-04 Identity = 19/32 (59.38%), Postives = 25/32 (78.12%), Query Frame = 0
BLAST of Carg14818-RA vs. TrEMBL
Match: tr|A0A0A0L4C2|A0A0A0L4C2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G124920 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 6.6e-16 Identity = 53/79 (67.09%), Postives = 56/79 (70.89%), Query Frame = 0
BLAST of Carg14818-RA vs. TrEMBL
Match: tr|A0A1S3AW95|A0A1S3AW95_CUCME (glyoxylate/hydroxypyruvate reductase HPR3-like OS=Cucumis melo OX=3656 GN=LOC103483323 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.1e-15 Identity = 52/79 (65.82%), Postives = 56/79 (70.89%), Query Frame = 0
BLAST of Carg14818-RA vs. TrEMBL
Match: tr|A0A0A0L908|A0A0A0L908_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G124900 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.1e-15 Identity = 51/79 (64.56%), Postives = 55/79 (69.62%), Query Frame = 0
BLAST of Carg14818-RA vs. TrEMBL
Match: tr|A0A1S3AW81|A0A1S3AW81_CUCME (glyoxylate/hydroxypyruvate reductase HPR3-like OS=Cucumis melo OX=3656 GN=LOC103483325 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.6e-14 Identity = 50/79 (63.29%), Postives = 55/79 (69.62%), Query Frame = 0
BLAST of Carg14818-RA vs. TrEMBL
Match: tr|A0A1S3AYM4|A0A1S3AYM4_CUCME (glyoxylate/hydroxypyruvate reductase HPR3-like OS=Cucumis melo OX=3656 GN=LOC103484170 PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.8e-14 Identity = 48/79 (60.76%), Postives = 54/79 (68.35%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
|