Bhi08M000465 (mRNA) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTGTCTACCCCTATGAGGAAAGCCAGGAAACAGGAATTAAAGTAGAAGATCTTTTAGCCCCTTATCGACGTGGAGGAAAAATAGGACTATTCGGAGGGGCTGGAGTGGGTAAAACAGTACTCATTATGGAATTGATCAACAACATTGCCAAAGCTCATGGAGGTGTATTCGTATTTGGAGGAGTAGATGAACGTACTCGTTCAGGAAATGATCTTTACATGGAAATGAAAGAATCTGGAGTAATTAATGAAGAAAATCTTGCAGAATCAAAAGTGGCTCTAGTCTACGGTCAGATGAATGAACTGTGGGGAGCTCGTATGAGAGTTGGTTCAACTGCCCTAACTATGGCGGAATATTTCTAA ATGCCTGTCTACCCCTATGAGGAAAGCCAGGAAACAGGAATTAAAGTAGAAGATCTTTTAGCCCCTTATCGACGTGGAGGAAAAATAGGACTATTCGGAGGGGCTGGAGTGGGTAAAACAGTACTCATTATGGAATTGATCAACAACATTGCCAAAGCTCATGGAGGTGTATTCGTATTTGGAGGAGTAGATGAACGTACTCGTTCAGGAAATGATCTTTACATGGAAATGAAAGAATCTGGAGTAATTAATGAAGAAAATCTTGCAGAATCAAAAGTGGCTCTAGTCTACGGTCAGATGAATGAACTGTGGGGAGCTCGTATGAGAGTTGGTTCAACTGCCCTAACTATGGCGGAATATTTCTAA ATGCCTGTCTACCCCTATGAGGAAAGCCAGGAAACAGGAATTAAAGTAGAAGATCTTTTAGCCCCTTATCGACGTGGAGGAAAAATAGGACTATTCGGAGGGGCTGGAGTGGGTAAAACAGTACTCATTATGGAATTGATCAACAACATTGCCAAAGCTCATGGAGGTGTATTCGTATTTGGAGGAGTAGATGAACGTACTCGTTCAGGAAATGATCTTTACATGGAAATGAAAGAATCTGGAGTAATTAATGAAGAAAATCTTGCAGAATCAAAAGTGGCTCTAGTCTACGGTCAGATGAATGAACTGTGGGGAGCTCGTATGAGAGTTGGTTCAACTGCCCTAACTATGGCGGAATATTTCTAA MPVYPYEESQETGIKVEDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVFVFGGVDERTRSGNDLYMEMKESGVINEENLAESKVALVYGQMNELWGARMRVGSTALTMAEYF
BLAST of Bhi08M000465 vs. Swiss-Prot
Match: sp|Q8S8W8|ATPB_ATRBE (ATP synthase subunit beta, chloroplastic OS=Atropa belladonna OX=33113 GN=atpB PE=3 SV=1) HSP 1 Score: 201.1 bits (510), Expect = 7.2e-51 Identity = 103/111 (92.79%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. Swiss-Prot
Match: sp|Q9MRR9|ATPB_BRASC (ATP synthase subunit beta, chloroplastic OS=Brasenia schreberi OX=4424 GN=atpB PE=3 SV=1) HSP 1 Score: 201.1 bits (510), Expect = 7.2e-51 Identity = 103/111 (92.79%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. Swiss-Prot
Match: sp|Q8MBM4|ATPB_CALSE (ATP synthase subunit beta, chloroplastic OS=Calystegia sepium OX=47519 GN=atpB PE=3 SV=1) HSP 1 Score: 201.1 bits (510), Expect = 7.2e-51 Identity = 103/111 (92.79%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. Swiss-Prot
Match: sp|Q9MRM0|ATPB_CANWI (ATP synthase subunit beta, chloroplastic OS=Canella winterana OX=3426 GN=atpB PE=3 SV=1) HSP 1 Score: 201.1 bits (510), Expect = 7.2e-51 Identity = 103/111 (92.79%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. Swiss-Prot
Match: sp|A6MMC9|ATPB_CHLSC (ATP synthase subunit beta, chloroplastic OS=Chloranthus spicatus OX=13006 GN=atpB PE=3 SV=1) HSP 1 Score: 201.1 bits (510), Expect = 7.2e-51 Identity = 103/111 (92.79%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. TAIR10
Match: ATCG00480.1 (ATP synthase subunit beta) HSP 1 Score: 200.7 bits (509), Expect = 5.2e-52 Identity = 103/111 (92.79%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. TAIR10
Match: AT5G08670.1 (ATP synthase alpha/beta family protein) HSP 1 Score: 166.8 bits (421), Expect = 8.4e-42 Identity = 89/116 (76.72%), Postives = 94/116 (81.03%), Query Frame = 0
BLAST of Bhi08M000465 vs. TAIR10
Match: AT5G08680.1 (ATP synthase alpha/beta family protein) HSP 1 Score: 166.8 bits (421), Expect = 8.4e-42 Identity = 89/116 (76.72%), Postives = 94/116 (81.03%), Query Frame = 0
BLAST of Bhi08M000465 vs. TAIR10
Match: AT5G08690.1 (ATP synthase alpha/beta family protein) HSP 1 Score: 166.8 bits (421), Expect = 8.4e-42 Identity = 89/116 (76.72%), Postives = 94/116 (81.03%), Query Frame = 0
BLAST of Bhi08M000465 vs. TrEMBL
Match: tr|A0A0H3VNB1|A0A0H3VNB1_9LILI (ATP synthase subunit beta, chloroplastic OS=Drymophloeus litigiosus OX=145687 GN=atpB PE=3 SV=1) HSP 1 Score: 202.2 bits (513), Expect = 6.6e-49 Identity = 103/111 (92.79%), Postives = 105/111 (94.59%), Query Frame = 0
BLAST of Bhi08M000465 vs. TrEMBL
Match: tr|A0A142DPV3|A0A142DPV3_9LAMI (ATP synthase subunit beta, chloroplastic OS=Phyllostegia velutina OX=141782 GN=atpB PE=3 SV=1) HSP 1 Score: 202.2 bits (513), Expect = 6.6e-49 Identity = 103/111 (92.79%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. TrEMBL
Match: tr|B3XY57|B3XY57_MELLF (ATP synthase subunit beta (Fragment) OS=Melicytus latifolius OX=212268 GN=atpB PE=3 SV=1) HSP 1 Score: 201.8 bits (512), Expect = 8.6e-49 Identity = 104/111 (93.69%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. TrEMBL
Match: tr|Q9MRG9|Q9MRG9_9ROSI (ATP synthase subunit beta (Fragment) OS=Melicytus alpinus OX=72460 GN=atpB PE=3 SV=2) HSP 1 Score: 201.8 bits (512), Expect = 8.6e-49 Identity = 104/111 (93.69%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. TrEMBL
Match: tr|B3XY59|B3XY59_9ROSI (ATP synthase subunit beta (Fragment) OS=Melicytus novae-zelandiae OX=450840 GN=atpB PE=3 SV=1) HSP 1 Score: 201.8 bits (512), Expect = 8.6e-49 Identity = 104/111 (93.69%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. NCBI nr
Match: AKF01380.1 (ATP synthase CF1 beta subunit (chloroplast) [Drymophloeus litigiosus]) HSP 1 Score: 202.2 bits (513), Expect = 9.9e-49 Identity = 103/111 (92.79%), Postives = 105/111 (94.59%), Query Frame = 0
BLAST of Bhi08M000465 vs. NCBI nr
Match: YP_009242334.1 (ATP synthase CF1 beta subunit (chloroplast) [Phyllostegia velutina] >AMQ33219.1 ATP synthase CF1 beta subunit (chloroplast) [Phyllostegia velutina]) HSP 1 Score: 202.2 bits (513), Expect = 9.9e-49 Identity = 103/111 (92.79%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. NCBI nr
Match: AAG43923.1 (ATP synthase beta subunit, partial (chloroplast) [Theophrasta americana]) HSP 1 Score: 201.8 bits (512), Expect = 1.3e-48 Identity = 104/111 (93.69%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. NCBI nr
Match: CAB90089.2 (ATP synthase beta subunit, partial (chloroplast) [Melicytus alpinus]) HSP 1 Score: 201.8 bits (512), Expect = 1.3e-48 Identity = 104/111 (93.69%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Bhi08M000465 vs. NCBI nr
Match: AGL73031.1 (ATP synthase beta subunit, partial (chloroplast) [Commelina communis]) HSP 1 Score: 201.8 bits (512), Expect = 1.3e-48 Identity = 104/111 (93.69%), Postives = 104/111 (93.69%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
|