Bhi08M000090 (mRNA) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGAAAGTGAAAGAGCCAACCACACCAAAGGCTGTAGAAGAGAGGCCTCAGGAAAATAGTGAAACTAGGCCATCTTATAATGAGACTGCAAATAACAACACCAACGCACCTGTTTCCATGGCACAGGTTGTGGGTTGGCCGCCCATAACATCTTTCAGGAAGAACACATTGGCTACAACTTCAAAGAACAATGATGAAGTTGTTGGAAAGGCAATGCCTGGGGCACTCTTTATCAAAGTCAGCATGGATGGTGCTCCATCTTAG ATGGGGAAAGTGAAAGAGCCAACCACACCAAAGGCTGTAGAAGAGAGGCCTCAGGAAAATAGTGAAACTAGGCCATCTTATAATGAGACTGCAAATAACAACACCAACGCACCTGTTTCCATGGCACAGGTTGTGGGTTGGCCGCCCATAACATCTTTCAGGAAGAACACATTGGCTACAACTTCAAAGAACAATGATGAAGTTGTTGGAAAGGCAATGCCTGGGGCACTCTTTATCAAAGTCAGCATGGATGGTGCTCCATCTTAG ATGGGGAAAGTGAAAGAGCCAACCACACCAAAGGCTGTAGAAGAGAGGCCTCAGGAAAATAGTGAAACTAGGCCATCTTATAATGAGACTGCAAATAACAACACCAACGCACCTGTTTCCATGGCACAGGTTGTGGGTTGGCCGCCCATAACATCTTTCAGGAAGAACACATTGGCTACAACTTCAAAGAACAATGATGAAGTTGTTGGAAAGGCAATGCCTGGGGCACTCTTTATCAAAGTCAGCATGGATGGTGCTCCATCTTAG MGKVKEPTTPKAVEERPQENSETRPSYNETANNNTNAPVSMAQVVGWPPITSFRKNTLATTSKNNDEVVGKAMPGALFIKVSMDGAPS
BLAST of Bhi08M000090 vs. Swiss-Prot
Match: sp|Q38826|IAA8_ARATH (Auxin-responsive protein IAA8 OS=Arabidopsis thaliana OX=3702 GN=IAA8 PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.5e-13 Identity = 38/53 (71.70%), Postives = 43/53 (81.13%), Query Frame = 0
BLAST of Bhi08M000090 vs. Swiss-Prot
Match: sp|Q38827|IAA9_ARATH (Auxin-responsive protein IAA9 OS=Arabidopsis thaliana OX=3702 GN=IAA9 PE=1 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.6e-13 Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of Bhi08M000090 vs. Swiss-Prot
Match: sp|Q5NB25|IAA3_ORYSJ (Auxin-responsive protein IAA3 OS=Oryza sativa subsp. japonica OX=39947 GN=IAA3 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.9e-09 Identity = 30/52 (57.69%), Postives = 37/52 (71.15%), Query Frame = 0
BLAST of Bhi08M000090 vs. Swiss-Prot
Match: sp|P13089|AUX28_SOYBN (Auxin-induced protein AUX28 OS=Glycine max OX=3847 GN=AUX28 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.9e-08 Identity = 34/83 (40.96%), Postives = 42/83 (50.60%), Query Frame = 0
BLAST of Bhi08M000090 vs. Swiss-Prot
Match: sp|Q75GB1|IAA17_ORYSJ (Auxin-responsive protein IAA17 OS=Oryza sativa subsp. japonica OX=39947 GN=IAA17 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.5e-08 Identity = 28/52 (53.85%), Postives = 36/52 (69.23%), Query Frame = 0
BLAST of Bhi08M000090 vs. TAIR10
Match: AT2G22670.4 (indoleacetic acid-induced protein 8) HSP 1 Score: 76.6 bits (187), Expect = 8.3e-15 Identity = 38/53 (71.70%), Postives = 43/53 (81.13%), Query Frame = 0
BLAST of Bhi08M000090 vs. TAIR10
Match: AT5G65670.1 (indole-3-acetic acid inducible 9) HSP 1 Score: 75.9 bits (185), Expect = 1.4e-14 Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of Bhi08M000090 vs. TAIR10
Match: AT4G29080.1 (phytochrome-associated protein 2) HSP 1 Score: 55.1 bits (131), Expect = 2.6e-08 Identity = 29/64 (45.31%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of Bhi08M000090 vs. TAIR10
Match: AT1G04240.1 (AUX/IAA transcriptional regulator family protein) HSP 1 Score: 50.8 bits (120), Expect = 4.9e-07 Identity = 25/68 (36.76%), Postives = 40/68 (58.82%), Query Frame = 0
BLAST of Bhi08M000090 vs. TAIR10
Match: AT1G04250.1 (AUX/IAA transcriptional regulator family protein) HSP 1 Score: 50.8 bits (120), Expect = 4.9e-07 Identity = 24/50 (48.00%), Postives = 32/50 (64.00%), Query Frame = 0
BLAST of Bhi08M000090 vs. TrEMBL
Match: tr|A0A1S3BBL3|A0A1S3BBL3_CUCME (Auxin-responsive protein OS=Cucumis melo OX=3656 GN=LOC103488149 PE=3 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 2.5e-34 Identity = 78/87 (89.66%), Postives = 82/87 (94.25%), Query Frame = 0
BLAST of Bhi08M000090 vs. TrEMBL
Match: tr|Q9SSY2|Q9SSY2_CUCSA (Auxin-responsive protein OS=Cucumis sativus OX=3659 GN=CsIAA2 PE=2 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 7.4e-34 Identity = 77/87 (88.51%), Postives = 81/87 (93.10%), Query Frame = 0
BLAST of Bhi08M000090 vs. TrEMBL
Match: tr|A0A061FFR0|A0A061FFR0_THECC (Auxin-responsive protein OS=Theobroma cacao OX=3641 GN=TCM_034577 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 5.9e-23 Identity = 60/85 (70.59%), Postives = 68/85 (80.00%), Query Frame = 0
BLAST of Bhi08M000090 vs. TrEMBL
Match: tr|A0A2P4ILX9|A0A2P4ILX9_QUESU (Auxin-responsive protein OS=Quercus suber OX=58331 GN=CFP56_49319 PE=3 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.7e-22 Identity = 56/83 (67.47%), Postives = 69/83 (83.13%), Query Frame = 0
BLAST of Bhi08M000090 vs. TrEMBL
Match: tr|A0A068FBF4|A0A068FBF4_9ROSI (Auxin-responsive protein OS=Dimocarpus longan OX=128017 GN=IAA8 PE=2 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 2.9e-22 Identity = 58/85 (68.24%), Postives = 67/85 (78.82%), Query Frame = 0
BLAST of Bhi08M000090 vs. NCBI nr
Match: XP_008444965.1 (PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]) HSP 1 Score: 153.3 bits (386), Expect = 3.8e-34 Identity = 78/87 (89.66%), Postives = 82/87 (94.25%), Query Frame = 0
BLAST of Bhi08M000090 vs. NCBI nr
Match: NP_001267710.1 (auxin-responsive protein IAA9-like [Cucumis sativus] >BAA85821.1 Aux/IAA protein [Cucumis sativus] >KGN62776.1 hypothetical protein Csa_2G372720 [Cucumis sativus]) HSP 1 Score: 151.8 bits (382), Expect = 1.1e-33 Identity = 77/87 (88.51%), Postives = 81/87 (93.10%), Query Frame = 0
BLAST of Bhi08M000090 vs. NCBI nr
Match: XP_022951336.1 (auxin-responsive protein IAA9-like [Cucurbita moschata] >XP_022951337.1 auxin-responsive protein IAA9-like [Cucurbita moschata] >XP_022951338.1 auxin-responsive protein IAA9-like [Cucurbita moschata]) HSP 1 Score: 150.6 bits (379), Expect = 2.5e-33 Identity = 77/87 (88.51%), Postives = 80/87 (91.95%), Query Frame = 0
BLAST of Bhi08M000090 vs. NCBI nr
Match: XP_023002083.1 (auxin-responsive protein IAA9-like [Cucurbita maxima] >XP_023002084.1 auxin-responsive protein IAA9-like [Cucurbita maxima] >XP_023002085.1 auxin-responsive protein IAA9-like [Cucurbita maxima]) HSP 1 Score: 150.6 bits (379), Expect = 2.5e-33 Identity = 77/87 (88.51%), Postives = 80/87 (91.95%), Query Frame = 0
BLAST of Bhi08M000090 vs. NCBI nr
Match: XP_023537439.1 (auxin-responsive protein IAA9-like [Cucurbita pepo subsp. pepo] >XP_023537440.1 auxin-responsive protein IAA9-like [Cucurbita pepo subsp. pepo] >XP_023537441.1 auxin-responsive protein IAA9-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 149.1 bits (375), Expect = 7.3e-33 Identity = 76/87 (87.36%), Postives = 79/87 (90.80%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
|