Bhi06M000758 (mRNA) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCGTTTGAGCCTGATAAGATTATGTGGTCTTCAGTATTAAACTCATGCAAAATTCATAAGAATCATGAATTGGCCAAGAAAGCAGCAGATCAGCTTTTTAATATGGAAAATTTTCGAGATGCTGCTCCTTATATCAACATGTCTAATATTTATGCAGTAGCTGGTCAGTGGACAATGTTGCAAAGGTCAAGAAGGCAATGA ATGCCGTTTGAGCCTGATAAGATTATGTGGTCTTCAGTATTAAACTCATGCAAAATTCATAAGAATCATGAATTGGCCAAGAAAGCAGCAGATCAGCTTTTTAATATGGAAAATTTTCGAGATGCTGCTCCTTATATCAACATGTCTAATATTTATGCAGTAGCTGGTCAGTGGACAATGTTGCAAAGGTCAAGAAGGCAATGA ATGCCGTTTGAGCCTGATAAGATTATGTGGTCTTCAGTATTAAACTCATGCAAAATTCATAAGAATCATGAATTGGCCAAGAAAGCAGCAGATCAGCTTTTTAATATGGAAAATTTTCGAGATGCTGCTCCTTATATCAACATGTCTAATATTTATGCAGTAGCTGGTCAGTGGACAATGTTGCAAAGGTCAAGAAGGCAATGA MPFEPDKIMWSSVLNSCKIHKNHELAKKAADQLFNMENFRDAAPYINMSNIYAVAGQWTMLQRSRRQ
BLAST of Bhi06M000758 vs. Swiss-Prot
Match: sp|Q9S7F4|PP206_ARATH (Putative pentatricopeptide repeat-containing protein At2g01510 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H36 PE=3 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 6.2e-20 Identity = 41/58 (70.69%), Postives = 52/58 (89.66%), Query Frame = 0
BLAST of Bhi06M000758 vs. Swiss-Prot
Match: sp|Q9SKQ4|PP167_ARATH (Pentatricopeptide repeat-containing protein At2g21090 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E48 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 9.6e-13 Identity = 32/65 (49.23%), Postives = 48/65 (73.85%), Query Frame = 0
BLAST of Bhi06M000758 vs. Swiss-Prot
Match: sp|P0C8Q2|PP323_ARATH (Pentatricopeptide repeat-containing protein At4g19191, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-E1 PE=2 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 8.2e-12 Identity = 32/65 (49.23%), Postives = 47/65 (72.31%), Query Frame = 0
BLAST of Bhi06M000758 vs. Swiss-Prot
Match: sp|Q9LNU6|PPR53_ARATH (Pentatricopeptide repeat-containing protein At1g20230 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H21 PE=2 SV=2) HSP 1 Score: 65.9 bits (159), Expect = 2.0e-10 Identity = 29/67 (43.28%), Postives = 45/67 (67.16%), Query Frame = 0
BLAST of Bhi06M000758 vs. Swiss-Prot
Match: sp|Q9FIF7|PP435_ARATH (Putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-E41 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.9e-09 Identity = 28/58 (48.28%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of Bhi06M000758 vs. TAIR10
Match: AT3G02010.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 97.4 bits (241), Expect = 3.5e-21 Identity = 41/58 (70.69%), Postives = 52/58 (89.66%), Query Frame = 0
BLAST of Bhi06M000758 vs. TAIR10
Match: AT2G21090.1 (Pentatricopeptide repeat (PPR-like) superfamily protein) HSP 1 Score: 73.6 bits (179), Expect = 5.3e-14 Identity = 32/65 (49.23%), Postives = 48/65 (73.85%), Query Frame = 0
BLAST of Bhi06M000758 vs. TAIR10
Match: AT4G19191.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 70.5 bits (171), Expect = 4.5e-13 Identity = 32/65 (49.23%), Postives = 47/65 (72.31%), Query Frame = 0
BLAST of Bhi06M000758 vs. TAIR10
Match: AT1G20230.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 65.9 bits (159), Expect = 1.1e-11 Identity = 29/67 (43.28%), Postives = 45/67 (67.16%), Query Frame = 0
BLAST of Bhi06M000758 vs. TAIR10
Match: AT5G59200.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 62.0 bits (149), Expect = 1.6e-10 Identity = 28/58 (48.28%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of Bhi06M000758 vs. TrEMBL
Match: tr|A0A1S3BNK2|A0A1S3BNK2_CUCME (putative pentatricopeptide repeat-containing protein At2g01510 OS=Cucumis melo OX=3656 GN=LOC103491821 PE=4 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 3.4e-23 Identity = 52/66 (78.79%), Postives = 60/66 (90.91%), Query Frame = 0
BLAST of Bhi06M000758 vs. TrEMBL
Match: tr|A0A0A0LBU3|A0A0A0LBU3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G560220 PE=4 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 3.4e-23 Identity = 52/66 (78.79%), Postives = 60/66 (90.91%), Query Frame = 0
BLAST of Bhi06M000758 vs. TrEMBL
Match: tr|A0A2N9FML6|A0A2N9FML6_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS16394 PE=4 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.4e-21 Identity = 49/66 (74.24%), Postives = 58/66 (87.88%), Query Frame = 0
BLAST of Bhi06M000758 vs. TrEMBL
Match: tr|A0A1Q3AVD5|A0A1Q3AVD5_CEPFO (PPR domain-containing protein/PPR_2 domain-containing protein/DYW_deaminase domain-containing protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_03044 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.9e-21 Identity = 47/58 (81.03%), Postives = 56/58 (96.55%), Query Frame = 0
BLAST of Bhi06M000758 vs. TrEMBL
Match: tr|A0A0R0FWL8|A0A0R0FWL8_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=GLYMA_16G049100 PE=4 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 1.2e-20 Identity = 47/66 (71.21%), Postives = 57/66 (86.36%), Query Frame = 0
BLAST of Bhi06M000758 vs. NCBI nr
Match: XP_022935227.1 (putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita moschata] >XP_022935228.1 putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita moschata] >XP_022935229.1 putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita moschata] >XP_022935230.1 putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita moschata] >XP_022935231.1 putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita moschata]) HSP 1 Score: 119.4 bits (298), Expect = 4.7e-24 Identity = 54/66 (81.82%), Postives = 60/66 (90.91%), Query Frame = 0
BLAST of Bhi06M000758 vs. NCBI nr
Match: XP_022983245.1 (putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita maxima]) HSP 1 Score: 119.4 bits (298), Expect = 4.7e-24 Identity = 54/66 (81.82%), Postives = 60/66 (90.91%), Query Frame = 0
BLAST of Bhi06M000758 vs. NCBI nr
Match: XP_023528913.1 (putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita pepo subsp. pepo] >XP_023528914.1 putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita pepo subsp. pepo] >XP_023528915.1 putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita pepo subsp. pepo] >XP_023528916.1 putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita pepo subsp. pepo] >XP_023528917.1 putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita pepo subsp. pepo] >XP_023528918.1 putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita pepo subsp. pepo] >XP_023528919.1 putative pentatricopeptide repeat-containing protein At2g01510 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 119.4 bits (298), Expect = 4.7e-24 Identity = 54/66 (81.82%), Postives = 60/66 (90.91%), Query Frame = 0
BLAST of Bhi06M000758 vs. NCBI nr
Match: XP_022156499.1 (putative pentatricopeptide repeat-containing protein At2g01510 [Momordica charantia]) HSP 1 Score: 117.9 bits (294), Expect = 1.4e-23 Identity = 53/66 (80.30%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of Bhi06M000758 vs. NCBI nr
Match: XP_004148020.1 (PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Cucumis sativus] >KGN58147.1 hypothetical protein Csa_3G560220 [Cucumis sativus]) HSP 1 Score: 115.9 bits (289), Expect = 5.2e-23 Identity = 52/66 (78.79%), Postives = 60/66 (90.91%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
|