Bhi05M000943 (mRNA) Wax gourd
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GGGATTTCATTGAAAGAGGAGCTGTGGAGAAGGCAATAAGAAGAGTTATAAAGGGAGAAGACATAGAGGATATGAGAAAAAAAGCTAAGGAATTGGCAAAGATGGAGAAGAAAGCTGTTGTAGAAAATGGATCTTCATATTTTGAATTGAAAGCTTTGATTAAGGAATTGGAATCATTAGCGTTTTGA GGGATTTCATTGAAAGAGGAGCTGTGGAGAAGGCAATAAGAAGAGTTATAAAGGGAGAAGACATAGAGGATATGAGAAAAAAAGCTAAGGAATTGGCAAAGATGGAGAAGAAAGCTGTTGTAGAAAATGGATCTTCATATTTTGAATTGAAAGCTTTGATTAAGGAATTGGAATCATTAGCGTTTTGA GGGATTTCATTGAAAGAGGAGCTGTGGAGAAGGCAATAAGAAGAGTTATAAAGGGAGAAGACATAGAGGATATGAGAAAAAAAGCTAAGGAATTGGCAAAGATGGAGAAGAAAGCTGTTGTAGAAAATGGATCTTCATATTTTGAATTGAAAGCTTTGATTAAGGAATTGGAATCATTAGCGTTTTGA DFIERGAVEKAIRRVIKGEDIEDMRKKAKELAKMEKKAVVENGSSYFELKALIKELESLAF
BLAST of Bhi05M000943 vs. Swiss-Prot
Match: sp|Q8W491|U73B3_ARATH (UDP-glycosyltransferase 73B3 OS=Arabidopsis thaliana OX=3702 GN=UGT73B3 PE=2 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.8e-05 Identity = 28/58 (48.28%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of Bhi05M000943 vs. Swiss-Prot
Match: sp|Q7Y232|U73B4_ARATH (UDP-glycosyltransferase 73B4 OS=Arabidopsis thaliana OX=3702 GN=UGT73B4 PE=2 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.8e-05 Identity = 28/54 (51.85%), Postives = 36/54 (66.67%), Query Frame = 0
BLAST of Bhi05M000943 vs. Swiss-Prot
Match: sp|Q2V6J9|UFOG7_FRAAN (UDP-glucose flavonoid 3-O-glucosyltransferase 7 OS=Fragaria ananassa OX=3747 GN=GT7 PE=1 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.8e-05 Identity = 24/59 (40.68%), Postives = 40/59 (67.80%), Query Frame = 0
BLAST of Bhi05M000943 vs. Swiss-Prot
Match: sp|Q8VZE9|U73B1_ARATH (UDP-glycosyltransferase 73B1 OS=Arabidopsis thaliana OX=3702 GN=UGT73B1 PE=2 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 5.2e-05 Identity = 30/56 (53.57%), Postives = 38/56 (67.86%), Query Frame = 0
BLAST of Bhi05M000943 vs. Swiss-Prot
Match: sp|Q9ZQG4|U73B5_ARATH (UDP-glycosyltransferase 73B5 OS=Arabidopsis thaliana OX=3702 GN=UGT73B5 PE=2 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 2.0e-04 Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 0
BLAST of Bhi05M000943 vs. TAIR10
Match: AT2G15490.1 (UDP-glycosyltransferase 73B4) HSP 1 Score: 49.3 bits (116), Expect = 9.8e-07 Identity = 28/54 (51.85%), Postives = 36/54 (66.67%), Query Frame = 0
BLAST of Bhi05M000943 vs. TAIR10
Match: AT4G34131.1 (UDP-glucosyl transferase 73B3) HSP 1 Score: 49.3 bits (116), Expect = 9.8e-07 Identity = 28/58 (48.28%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of Bhi05M000943 vs. TAIR10
Match: AT4G34138.1 (UDP-glucosyl transferase 73B1) HSP 1 Score: 47.8 bits (112), Expect = 2.9e-06 Identity = 30/56 (53.57%), Postives = 38/56 (67.86%), Query Frame = 0
BLAST of Bhi05M000943 vs. TAIR10
Match: AT2G15480.1 (UDP-glucosyl transferase 73B5) HSP 1 Score: 45.8 bits (107), Expect = 1.1e-05 Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 0
BLAST of Bhi05M000943 vs. TAIR10
Match: AT3G46670.1 (UDP-glucosyl transferase 76E11) HSP 1 Score: 39.7 bits (91), Expect = 7.8e-04 Identity = 21/57 (36.84%), Postives = 38/57 (66.67%), Query Frame = 0
BLAST of Bhi05M000943 vs. TrEMBL
Match: tr|A0A1S4E0C3|A0A1S4E0C3_CUCME (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495250 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.5e-12 Identity = 42/61 (68.85%), Postives = 53/61 (86.89%), Query Frame = 0
BLAST of Bhi05M000943 vs. TrEMBL
Match: tr|A0A1S4E112|A0A1S4E112_CUCME (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC107991336 PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 9.4e-12 Identity = 40/60 (66.67%), Postives = 51/60 (85.00%), Query Frame = 0
BLAST of Bhi05M000943 vs. TrEMBL
Match: tr|A0A1S3BZW4|A0A1S3BZW4_CUCME (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495253 PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.2e-11 Identity = 42/61 (68.85%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of Bhi05M000943 vs. TrEMBL
Match: tr|A0A0A0K4P5|A0A0A0K4P5_CUCSA (Glycosyltransferase OS=Cucumis sativus OX=3659 GN=Csa_7G073500 PE=3 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 4.7e-11 Identity = 39/60 (65.00%), Postives = 51/60 (85.00%), Query Frame = 0
BLAST of Bhi05M000943 vs. TrEMBL
Match: tr|A0A0A0K347|A0A0A0K347_CUCSA (Glycosyltransferase OS=Cucumis sativus OX=3659 GN=Csa_7G073490 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 6.1e-11 Identity = 41/61 (67.21%), Postives = 50/61 (81.97%), Query Frame = 0
BLAST of Bhi05M000943 vs. NCBI nr
Match: XP_022972392.1 (scopoletin glucosyltransferase-like [Cucurbita maxima]) HSP 1 Score: 82.8 bits (203), Expect = 4.4e-13 Identity = 43/61 (70.49%), Postives = 53/61 (86.89%), Query Frame = 0
BLAST of Bhi05M000943 vs. NCBI nr
Match: XP_016901676.1 (PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]) HSP 1 Score: 79.7 bits (195), Expect = 3.7e-12 Identity = 42/61 (68.85%), Postives = 53/61 (86.89%), Query Frame = 0
BLAST of Bhi05M000943 vs. NCBI nr
Match: XP_022972391.1 (scopoletin glucosyltransferase-like [Cucurbita maxima]) HSP 1 Score: 78.6 bits (192), Expect = 8.3e-12 Identity = 42/61 (68.85%), Postives = 52/61 (85.25%), Query Frame = 0
BLAST of Bhi05M000943 vs. NCBI nr
Match: XP_016901675.1 (PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]) HSP 1 Score: 77.8 bits (190), Expect = 1.4e-11 Identity = 40/60 (66.67%), Postives = 51/60 (85.00%), Query Frame = 0
BLAST of Bhi05M000943 vs. NCBI nr
Match: XP_008454969.1 (PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]) HSP 1 Score: 77.4 bits (189), Expect = 1.9e-11 Identity = 42/61 (68.85%), Postives = 51/61 (83.61%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
|