Bhi04M000088 (mRNA) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGGTCAACCGTATTCTGAAACACGGAAAAAAATCATTGGCTTATCAAATTATCTATCGAGCCATGAAAAAGAATCAACAAAAGACAGAAACAAATCCACTATTTGTTTTACGTCAAGCAATACGTGGAGTAACTCCCGATATAGCAGTAAAGGCAAGACGTGTAGGCGGATCAACTCATCAAGTTCCCATTGAAATAGAATCCACACAAGGAAAAGCACTTGCCATTCGTTGGTTATTAGGGGCATCCCGAAAATGTCCGGGTTAA ATGTTGGTCAACCGTATTCTGAAACACGGAAAAAAATCATTGGCTTATCAAATTATCTATCGAGCCATGAAAAAGAATCAACAAAAGACAGAAACAAATCCACTATTTGTTTTACGTCAAGCAATACGTGGAGTAACTCCCGATATAGCAGTAAAGGCAAGACGTGTAGGCGGATCAACTCATCAAGTTCCCATTGAAATAGAATCCACACAAGGAAAAGCACTTGCCATTCGTTGGTTATTAGGGGCATCCCGAAAATGTCCGGGTTAA ATGTTGGTCAACCGTATTCTGAAACACGGAAAAAAATCATTGGCTTATCAAATTATCTATCGAGCCATGAAAAAGAATCAACAAAAGACAGAAACAAATCCACTATTTGTTTTACGTCAAGCAATACGTGGAGTAACTCCCGATATAGCAGTAAAGGCAAGACGTGTAGGCGGATCAACTCATCAAGTTCCCATTGAAATAGAATCCACACAAGGAAAAGCACTTGCCATTCGTTGGTTATTAGGGGCATCCCGAAAATGTCCGGGTTAA MLVNRILKHGKKSLAYQIIYRAMKKNQQKTETNPLFVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIESTQGKALAIRWLLGASRKCPG
BLAST of Bhi04M000088 vs. Swiss-Prot
Match: sp|Q4VZK9|RR7_CUCSA (30S ribosomal protein S7, chloroplastic OS=Cucumis sativus OX=3659 GN=rps7-A PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 9.4e-40 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. Swiss-Prot
Match: sp|Q49KT8|RR7_EUCGG (30S ribosomal protein S7, chloroplastic OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rps7-A PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 9.4e-40 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. Swiss-Prot
Match: sp|Q6KGY2|RR7_GUNCH (30S ribosomal protein S7, chloroplastic OS=Gunnera chilensis OX=130722 GN=rps7 PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 9.4e-40 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. Swiss-Prot
Match: sp|Q9B1A1|RR7_LOTJA (30S ribosomal protein S7, chloroplastic OS=Lotus japonicus OX=34305 GN=rps7-A PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 9.4e-40 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. Swiss-Prot
Match: sp|B1NWJ5|RR7_MANES (30S ribosomal protein S7, chloroplastic OS=Manihot esculenta OX=3983 GN=rps7-A PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 9.4e-40 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. TAIR10
Match: ATCG01240.1 (ribosomal protein S7) HSP 1 Score: 162.5 bits (410), Expect = 1.2e-40 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. TAIR10
Match: ATCG00900.1 (Ribosomal protein S7p/S5e family protein) HSP 1 Score: 162.5 bits (410), Expect = 1.2e-40 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. TrEMBL
Match: tr|A0A0S1RS49|A0A0S1RS49_9ASPA (30S ribosomal protein S7, chloroplastic OS=Polygonatum cyrtonema OX=195526 GN=rps7 PE=3 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 2.2e-38 Identity = 85/89 (95.51%), Postives = 86/89 (96.63%), Query Frame = 0
BLAST of Bhi04M000088 vs. TrEMBL
Match: tr|A0A1V0IRS8|A0A1V0IRS8_RUBNI (Ribosomal protein S7 OS=Rubus niveus OX=59495 GN=rps7 PE=3 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 1.1e-37 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. TrEMBL
Match: tr|A0A223FXW0|A0A223FXW0_9ROSA (30S ribosomal protein S7, chloroplastic OS=Malus trilobata OX=106570 GN=rps7 PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 1.9e-37 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. TrEMBL
Match: tr|A0A1C9UAE5|A0A1C9UAE5_9MYRT (30S ribosomal protein S7, chloroplastic OS=Ludwigia octovalvis OX=883788 GN=rps7 PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 1.9e-37 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. TrEMBL
Match: tr|A0A1I9VVG3|A0A1I9VVG3_9MYRT (30S ribosomal protein S7, chloroplastic OS=Henriettea barkeri OX=1630365 GN=rps7 PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 1.9e-37 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. NCBI nr
Match: YP_009180153.1 (ribosomal protein S7 (chloroplast) [Polygonatum cyrtonema] >YP_009180165.1 ribosomal protein S7 (chloroplast) [Polygonatum cyrtonema] >ALL96508.1 ribosomal protein S7 (chloroplast) [Polygonatum cyrtonema] >ALL96509.1 ribosomal protein S7 (chloroplast) [Polygonatum cyrtonema]) HSP 1 Score: 166.8 bits (421), Expect = 3.4e-38 Identity = 85/89 (95.51%), Postives = 86/89 (96.63%), Query Frame = 0
BLAST of Bhi04M000088 vs. NCBI nr
Match: ARC99174.1 (ribosomal protein S7 (plastid) [Rubus niveus]) HSP 1 Score: 164.5 bits (415), Expect = 1.7e-37 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. NCBI nr
Match: YP_004021710.1 (ribosomal protein S7 [Prunus persica] >YP_004021723.1 ribosomal protein S7 [Prunus persica] >YP_004286147.1 ribosomal protein S7 [Fragaria vesca subsp. vesca] >YP_004286161.1 ribosomal protein S7 [Fragaria vesca subsp. vesca] >YP_004842283.1 ribosomal protein S7 [Pyrus pyrifolia] >YP_004842296.1 ribosomal protein S7 [Pyrus pyrifolia] >YP_006883308.1 ribosomal protein S7 (chloroplast) [Fragaria vesca subsp. bracteata] >YP_006883381.1 ribosomal protein S7 [Fragaria mandshurica] >YP_007025428.1 ribosomal protein S7 (chloroplast) [Fragaria chiloensis] >YP_007025442.1 ribosomal protein S7 (chloroplast) [Fragaria chiloensis] >YP_007025513.1 ribosomal protein S7 (chloroplast) [Fragaria virginiana] >YP_007025527.1 ribosomal protein S7 (chloroplast) [Fragaria virginiana] >YP_008082778.1 ribosomal protein S7 [Prinsepia utilis] >YP_008082791.1 ribosomal protein S7 [Prinsepia utilis] >YP_008965537.1 ribosomal protein S7 [Pyrus spinosa] >YP_008965551.1 ribosomal protein S7 [Pyrus spinosa] >YP_009020084.1 ribosomal protein S7 (plastid) [Prunus mume] >YP_009020097.1 ribosomal protein S7 (plastid) [Prunus mume] >YP_009024726.1 ribosomal protein S7 (chloroplast) [Prunus kansuensis] >YP_009024740.1 ribosomal protein S7 (chloroplast) [Prunus kansuensis] >YP_009040252.1 ribosomal protein S7 (plastid) [Fragaria iinumae] >YP_009040266.1 ribosomal protein S7 (plastid) [Fragaria iinumae] >YP_009136356.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] >YP_009136369.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] >YP_009136440.1 ribosomal protein S7 (chloroplast) [Prunus maximowiczii] >YP_009136453.1 ribosomal protein S7 (chloroplast) [Prunus maximowiczii] >YP_009266649.1 ribosomal protein S7 (chloroplast) [Prunus pseudocerasus] >YP_009266663.1 ribosomal protein S7 (chloroplast) [Prunus pseudocerasus] >YP_009295481.1 ribosomal protein S7 (chloroplast) [Malus prunifolia] >YP_009295467.1 ribosomal protein S7 (chloroplast) [Malus prunifolia] >YP_009326463.1 30S ribosomal protein S7 (chloroplast) [Rosa roxburghii] >YP_009326479.1 30S ribosomal protein S7 (chloroplast) [Rosa roxburghii] >YP_009349455.1 ribosomal protein S7 (chloroplast) [Sorbus torminalis] >YP_009349468.1 ribosomal protein S7 (chloroplast) [Sorbus torminalis] >YP_009355737.1 ribosomal protein S7 (chloroplast) [Fragaria pentaphylla] >YP_009355751.1 ribosomal protein S7 (chloroplast) [Fragaria pentaphylla] >YP_009363268.1 ribosomal protein S7 (chloroplast) [Eriobotrya japonica] >YP_009363281.1 ribosomal protein S7 (chloroplast) [Eriobotrya japonica] >YP_009366387.1 ribosomal protein S7 (plastid) [Prunus dulcis] >YP_009366401.1 ribosomal protein S7 (plastid) [Prunus dulcis] >YP_009378540.1 ribosomal protein S7 (chloroplast) [Pyrus pashia] >YP_009378553.1 ribosomal protein S7 (chloroplast) [Pyrus pashia] >YP_009409003.1 ribosomal protein S7 (chloroplast) [Fragaria nipponica] >YP_009409016.1 ribosomal protein S7 (chloroplast) [Fragaria nipponica] >YP_009409087.1 ribosomal protein S7 (chloroplast) [Fragaria orientalis] >YP_009409100.1 ribosomal protein S7 (chloroplast) [Fragaria orientalis] >YP_009412959.1 ribosomal protein S7 (chloroplast) [Chaenomeles japonica] >YP_009412972.1 ribosomal protein S7 (chloroplast) [Chaenomeles japonica] >YP_009414870.1 ribosomal protein S7 (chloroplast) [Malus florentina] >YP_009414883.1 ribosomal protein S7 (chloroplast) [Malus florentina] >YP_009417186.1 ribosomal protein S7 (chloroplast) [Malus trilobata] >YP_009417199.1 ribosomal protein S7 (chloroplast) [Malus trilobata] >YP_009417269.1 ribosomal protein S7 (chloroplast) [Malus tschonoskii] >YP_009417282.1 ribosomal protein S7 (chloroplast) [Malus tschonoskii] >YP_009428320.1 ribosomal protein S7 (chloroplast) [Prunus humilis] >YP_009428333.1 ribosomal protein S7 (chloroplast) [Prunus humilis] >YP_009428925.1 ribosomal protein S7 (chloroplast) [Prunus cerasoides] >YP_009428938.1 ribosomal protein S7 (chloroplast) [Prunus cerasoides] >YP_009430587.1 ribosomal protein S7 (chloroplast) [Fragaria x ananassa] >YP_009430601.1 ribosomal protein S7 (chloroplast) [Fragaria x ananassa] >YP_009444077.1 ribosomal protein S7 (chloroplast) [Malus micromalus] >YP_009444091.1 ribosomal protein S7 (chloroplast) [Malus micromalus] >YP_009444820.1 ribosomal protein S7 (plastid) [Prunus tomentosa] >YP_009444838.1 ribosomal protein S7 (plastid) [Prunus tomentosa] >YP_009445702.1 ribosomal protein S7 (chloroplast) [Dasiphora fruticosa] >YP_009445715.1 ribosomal protein S7 (chloroplast) [Dasiphora fruticosa] >YP_009464073.1 ribosomal protein S7 (plastid) [Sorbus ulleungensis] >YP_009464059.1 ribosomal protein S7 (plastid) [Sorbus ulleungensis] >YP_009479036.1 30S ribosomal protein S7 (chloroplast) [Rosa praelucens] >YP_009479049.1 30S ribosomal protein S7 (chloroplast) [Rosa praelucens] >YP_009489273.1 ribosomal protein S7 (chloroplast) [Prunus pedunculata] >YP_009489286.1 ribosomal protein S7 (chloroplast) [Prunus pedunculata] >YP_009495655.1 ribosomal protein S7 (chloroplast) [Rubus takesimensis] >YP_009495669.1 ribosomal protein S7 (chloroplast) [Rubus takesimensis] >YP_009489189.1 ribosomal protein S7 (chloroplast) [Prunus mongolica] >YP_009489202.1 ribosomal protein S7 (chloroplast) [Prunus mongolica] >YP_009500535.1 30S ribosomal protein S7 (chloroplast) [Rosa chinensis var. spontanea] >YP_009500548.1 30S ribosomal protein S7 (chloroplast) [Rosa chinensis var. spontanea] >ABG76915.1 ribosomal protein S7 (chloroplast) [Fragaria x ananassa] >ABG76922.1 ribosomal protein S7 (chloroplast) [Prunus persica] >ADO65020.1 ribosomal protein S7 (chloroplast) [Prunus persica] >ADO65034.1 ribosomal protein S7 (chloroplast) [Prunus persica] >ADY15396.1 ribosomal protein S7 (chloroplast) [Fragaria vesca subsp. vesca] >ADY15411.1 ribosomal protein S7 (chloroplast) [Fragaria vesca subsp. vesca] >BAK69427.1 ribosomal protein S7 (chloroplast) [Pyrus pyrifolia] >BAK69441.1 ribosomal protein S7 (chloroplast) [Pyrus pyrifolia] >AET62700.1 ribosomal protein S7 (chloroplast) [Fragaria chiloensis] >AET62714.1 ribosomal protein S7 (chloroplast) [Fragaria chiloensis] >AET62785.1 ribosomal protein S7 (chloroplast) [Fragaria virginiana] >AET62799.1 ribosomal protein S7 (chloroplast) [Fragaria virginiana] >AFC17687.1 ribosomal protein S7 (chloroplast) [Fragaria vesca subsp. bracteata] >AFC17760.1 ribosomal protein S7 (plastid) [Fragaria mandshurica] >AFQ39463.1 ribosomal protein S7 (plastid) [Fragaria x ananassa subsp. cuneifolia] >AFQ39472.1 ribosomal protein S7 (plastid) [Fragaria virginiana] >AFQ39481.1 ribosomal protein S7 (plastid) [Fragaria bucharica] >AFQ39490.1 ribosomal protein S7 (plastid) [Fragaria orientalis] >AFQ39499.1 ribosomal protein S7 (plastid) [Fragaria viridis] >AFQ39508.1 ribosomal protein S7 (plastid) [Fragaria nilgerrensis] >AFQ39517.1 ribosomal protein S7 (plastid) [Fragaria chinensis] >AFQ39526.1 ribosomal protein S7 (plastid) [Fragaria moupinensis] >AFQ39535.1 ribosomal protein S7 (plastid) [Fragaria tibetica] >AFQ39544.1 ribosomal protein S7 (plastid) [Fragaria corymbosa] >AFQ39553.1 ribosomal protein S7 (plastid) [Fragaria gracilis] >AFS89535.1 ribosomal protein S7 (chloroplast) [Fragaria chiloensis] >AGL94744.1 ribosomal protein S7 (plastid) [Prinsepia utilis] >AGL94758.1 ribosomal protein S7 (plastid) [Prinsepia utilis] >AGN71755.1 ribosomal protein S7 (plastid) [Fragaria vesca subsp. bracteata] >AGN71769.1 ribosomal protein S7 (plastid) [Fragaria vesca subsp. bracteata] >AGN71840.1 ribosomal protein S7 (plastid) [Fragaria vesca subsp. bracteata] >AGN71854.1 ribosomal protein S7 (plastid) [Fragaria vesca subsp. bracteata] >AGN71925.1 ribosomal protein S7 (plastid) [Fragaria vesca subsp. bracteata] >AGN71939.1 ribosomal protein S7 (plastid) [Fragaria vesca subsp. bracteata] >AGN72010.1 ribosomal protein S7 (plastid) [Dasiphora fruticosa subsp. floribunda] >AGN72024.1 ribosomal protein S7 (plastid) [Dasiphora fruticosa subsp. floribunda] >AGN72095.1 ribosomal protein S7 (plastid) [Fragaria iinumae] >AGN72109.1 ribosomal protein S7 (plastid) [Fragaria iinumae] >AGN72180.1 ribosomal protein S7 (plastid) [Fragaria mandshurica] >AGN72194.1 ribosomal protein S7 (plastid) [Fragaria mandshurica] >CDI73609.1 ribosomal protein S7 (plastid) [Pyrus spinosa] >CDI73624.1 ribosomal protein S7 (plastid) [Pyrus spinosa] >AHF72039.1 30S ribosomal protein S7 (chloroplast) [Rosa odorata var. gigantea] >AHF72040.1 30S ribosomal protein S7 (chloroplast) [Rosa odorata var. gigantea] >AHK26918.1 ribosomal protein S7 (plastid) [Prunus mume] >AHK26931.1 ribosomal protein S7 (plastid) [Prunus mume] >AHN13581.1 ribosomal protein S7 (chloroplast) [Prunus kansuensis] >AHN13595.1 ribosomal protein S7 (chloroplast) [Prunus kansuensis] >AKC99561.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] >AKC99573.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] >AKC99646.1 ribosomal protein S7 (chloroplast) [Prunus maximowiczii] >AKC99659.1 ribosomal protein S7 (chloroplast) [Prunus maximowiczii] >AKC99814.1 ribosomal protein S7 (chloroplast) [Prunus serrulata var. spontanea] >AKC99827.1 ribosomal protein S7 (chloroplast) [Prunus serrulata var. spontanea] >AKC99901.1 ribosomal protein S7 (chloroplast) [Prunus subhirtella var. subhirtella] >AKC99914.1 ribosomal protein S7 (chloroplast) [Prunus subhirtella var. subhirtella] >AKC99982.1 ribosomal protein S7 (chloroplast) [Prunus subhirtella var. subhirtella] >AKC99995.1 ribosomal protein S7 (chloroplast) [Prunus subhirtella var. subhirtella] >AKI30893.1 ribosomal protein S7 (chloroplast) [Fragaria chiloensis] >AKI30972.1 ribosomal protein S7 (chloroplast) [Fragaria mandshurica] >AKI31049.1 ribosomal protein S7 (chloroplast) [Fragaria vesca subsp. bracteata] >AKI31127.1 ribosomal protein S7 (chloroplast) [Fragaria iinumae] >AKI31170.1 ribosomal protein S7 (chloroplast) [Fragaria vesca subsp. bracteata] >AKI31284.1 ribosomal protein S7 (chloroplast) [Fragaria virginiana] >AKN00100.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] >AKN00113.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] >ANA10313.1 ribosomal protein S7 (chloroplast) [Eriobotrya japonica] >ANA10326.1 ribosomal protein S7 (chloroplast) [Eriobotrya japonica] >ANI86520.1 ribosomal protein S7 (chloroplast) [Chaenomeles speciosa] >ANI86533.1 ribosomal protein S7 (chloroplast) [Chaenomeles speciosa] >ANI86604.1 ribosomal protein S7 (chloroplast) [Chaenomeles japonica] >ANI86617.1 ribosomal protein S7 (chloroplast) [Chaenomeles japonica] >ANI86688.1 ribosomal protein S7 (chloroplast) [Chaenomeles sinensis] >ANI86701.1 ribosomal protein S7 (chloroplast) [Chaenomeles sinensis] >ANK79021.1 ribosomal protein S7 (chloroplast) [Prunus pseudocerasus] >ANK79022.1 ribosomal protein S7 (chloroplast) [Prunus pseudocerasus] >ANY93422.1 ribosomal protein S7 (chloroplast) [Hagenia abyssinica] >ANY93444.1 ribosomal protein S7 (chloroplast) [Hagenia abyssinica] >AOI20295.1 ribosomal protein S7 (chloroplast) [Malus prunifolia] >AOI20296.1 ribosomal protein S7 (chloroplast) [Malus prunifolia] >APD28278.1 30S ribosomal protein S7 (chloroplast) [Rosa roxburghii] >APD28294.1 30S ribosomal protein S7 (chloroplast) [Rosa roxburghii] >AQK77939.1 ribosomal protein S7 (chloroplast) [Sorbus torminalis] >AQK77952.1 ribosomal protein S7 (chloroplast) [Sorbus torminalis] >AQR56739.1 ribosomal protein S7 (chloroplast) [Adenostoma fasciculatum] >AQT19317.1 ribosomal protein S7 (chloroplast) [Cydonia oblonga] >AQT19330.1 ribosomal protein S7 (chloroplast) [Cydonia oblonga] >AQT19399.1 ribosomal protein S7 (chloroplast) [Malus baccata] >AQT19412.1 ribosomal protein S7 (chloroplast) [Malus baccata] >AQT19482.1 ribosomal protein S7 (chloroplast) [Docynia delavayi] >AQT19495.1 ribosomal protein S7 (chloroplast) [Docynia delavayi] >AQT19565.1 ribosomal protein S7 (chloroplast) [Malus doumeri] >AQT19578.1 ribosomal protein S7 (chloroplast) [Malus doumeri] >AQV10011.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] >AQV10012.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] >AQW41474.1 ribosomal protein S7 (chloroplast) [Fragaria x ananassa] >AQW41488.1 ribosomal protein S7 (chloroplast) [Fragaria x ananassa] >ARB52411.1 ribosomal protein S7 (chloroplast) [Fragaria pentaphylla] >ARB52426.1 ribosomal protein S7 (chloroplast) [Fragaria pentaphylla] >ARC95767.1 ribosomal protein S7 (plastid) [Cotoneaster horizontalis] >ARC95845.1 ribosomal protein S7 (plastid) [Rosa persica] >ARC95922.1 ribosomal protein S7 (plastid) [Pourthiaea arguta var. salicifolia] >ARC96155.1 ribosomal protein S7 (plastid) [Eriobotrya bengalensis var. angustifolia] >ARC96232.1 ribosomal protein S7 (plastid) [Oemleria cerasiformis] >ARC96309.1 ribosomal protein S7 (plastid) [Sorbus helenae] >ARC96386.1 ribosomal protein S7 (plastid) [Vauquelinia californica] >ARC96464.1 ribosomal protein S7 (plastid) [Aruncus dioicus] >ARC96541.1 ribosomal protein S7 (plastid) [Rhaphiolepis indica] >ARC96618.1 ribosomal protein S7 (plastid) [Sorbaria sorbifolia] >ARC96696.1 ribosomal protein S7 (plastid) [Leucosidea sericea] >ARC96773.1 ribosomal protein S7 (plastid) [Physocarpus sp. A SCZ-2017] >ARC96850.1 ribosomal protein S7 (plastid) [Rhaphiolepis umbellata] >ARC96928.1 ribosomal protein S7 (plastid) [Aruncus dioicus] >ARC97005.1 ribosomal protein S7 (plastid) [Photinia integrifolia] >ARC97083.1 ribosomal protein S7 (plastid) [Rosa lichiangensis] >ARC97161.1 ribosomal protein S7 (plastid) [Sibbaldia procumbens] >ARC97239.1 ribosomal protein S7 (plastid) [Geum macrophyllum] >ARC97548.1 ribosomal protein S7 (plastid) [Osteomeles anthyllidifolia] >ARC97703.1 ribosomal protein S7 (plastid) [Agrimonia pilosa] >ARC97780.1 ribosomal protein S7 (plastid) [Cotoneaster salicifolius] >ARC97857.1 ribosomal protein S7 (plastid) [Physocarpus sp. B SCZ-2017] >ARC97934.1 ribosomal protein S7 (plastid) [Crataegus pinnatifida var. major] >ARC98011.1 ribosomal protein S7 (plastid) [Photinia prionophylla] >ARC98088.1 ribosomal protein S7 (plastid) [Crataegus chungtienensis] >ARC98244.1 ribosomal protein S7 (plastid) [Potentilla lineata] >ARC98398.1 ribosomal protein S7 (plastid) [Rhodotypos scandens] >ARC98553.1 ribosomal protein S7 (plastid) [Potentilla purpurea] >ARC98630.1 ribosomal protein S7 (plastid) [Pyracantha fortuneana] >ARC98708.1 ribosomal protein S7 (plastid) [Sibiraea angustata] >ARC98785.1 ribosomal protein S7 (plastid) [Cormus domestica] >ARC98862.1 ribosomal protein S7 (plastid) [Pyracantha angustifolia] >ARC98940.1 ribosomal protein S7 (plastid) [Rubus corchorifolius] >ARC99018.1 ribosomal protein S7 (plastid) [Potaninia mongolica] >ARC99096.1 ribosomal protein S7 (plastid) [Rosa roxburghii f. normalis] >ARC99251.1 ribosomal protein S7 (plastid) [Sorbus rhamnoides] >ARC99404.1 ribosomal protein S7 (plastid) [Sorbus sp. SCZ-2017] >ARC99481.1 ribosomal protein S7 (plastid) [Heteromeles arbutifolia] >ARC99636.1 ribosomal protein S7 (plastid) [Coleogyne ramosissima] >ARC99714.1 ribosomal protein S7 (plastid) [Potentilla lancinata] >ARC99791.1 ribosomal protein S7 (plastid) [Neillia serratisepala] >ARC99869.1 ribosomal protein S7 (plastid) [Petrophytum caespitosum] >ARC99946.1 ribosomal protein S7 (plastid) [Luetkea pectinata] >ARD00178.1 ribosomal protein S7 (plastid) [Pyrus pashia] >ARD00334.1 ribosomal protein S7 (plastid) [Geum elatum] >ARD00412.1 ribosomal protein S7 (plastid) [Geum triflorum] >ARD00488.1 ribosomal protein S7 (plastid) [Amelanchier alnifolia] >ARD00566.1 ribosomal protein S7 (plastid) [Potentilla purpurascens] >ARD00643.1 ribosomal protein S7 (plastid) [Neviusia cliftonii] >ARD00720.1 ribosomal protein S7 (plastid) [Prunus andersonii] >ARD00797.1 ribosomal protein S7 (plastid) [Malacomeles denticulata] >ARD01030.1 ribosomal protein S7 (plastid) [Prinsepia sinensis] >ARD01186.1 ribosomal protein S7 (plastid) [Spiraea martini] >ARD01264.1 ribosomal protein S7 (plastid) [Kelseya uniflora] >ARD01419.1 ribosomal protein S7 (plastid) [Sorbus rufopilosa] >ARD01652.1 ribosomal protein S7 (plastid) [Sibbaldianthe sericea] >ARD01729.1 ribosomal protein S7 (plastid) [Cotoneaster franchetii] >ARD01807.1 ribosomal protein S7 (plastid) [Spenceria ramalana] >ARD01883.1 ribosomal protein S7 (plastid) [Gillenia stipulata] >ARD02035.1 ribosomal protein S7 (plastid) [Amelanchier sinica] >ARD02113.1 ribosomal protein S7 (plastid) [Fallugia paradoxa] >ARD02268.1 ribosomal protein S7 (plastid) [Chamaerhodos erecta] >ARD02345.1 ribosomal protein S7 (plastid) [Prunus salicina] >ARD02422.1 ribosomal protein S7 (plastid) [Stranvaesia davidiana] >ARD02575.1 ribosomal protein S7 (plastid) [Lyonothamnus floribundus] >ARD02652.1 ribosomal protein S7 (plastid) [Neillia gracilis] >ARD02729.1 ribosomal protein S7 (plastid) [Aronia melanocarpa] >ARD02961.1 ribosomal protein S7 (plastid) [Sorbus alnifolia] >ARD03038.1 ribosomal protein S7 (plastid) [Peraphyllum ramosissimum] >ARD03115.1 ribosomal protein S7 (plastid) [Exochorda serratifolia] >ARD03193.1 ribosomal protein S7 (plastid) [Holodiscus argenteus] >ARD03271.1 ribosomal protein S7 (plastid) [Potentilla indica] >ARD03349.1 ribosomal protein S7 (plastid) [Drymocallis glandulosa] >ARD03427.1 ribosomal protein S7 (plastid) [Dasiphora fruticosa] >ARD03504.1 ribosomal protein S7 (plastid) [Chamaebatiaria millefolium] >ARD03811.1 ribosomal protein S7 (plastid) [Potentilla micropetala] >ARD03888.1 ribosomal protein S7 (plastid) [Mespilus canescens] >ARD04120.1 ribosomal protein S7 (plastid) [Prunus armeniaca] >ARD04198.1 ribosomal protein S7 (plastid) [Hagenia abyssinica] >ARD04275.1 ribosomal protein S7 (plastid) [Kageneckia crataegifolia] >ARD04353.1 ribosomal protein S7 (plastid) [Potentilla tilingii] >ARD04584.1 ribosomal protein S7 (plastid) [Dichotomanthes tristaniicarpa] >ARD04662.1 ribosomal protein S7 (plastid) [Holodiscus discolor] >ARD04740.1 ribosomal protein S7 (plastid) [Potentilla parvifolia] >ARD04819.1 ribosomal protein S7 (plastid) [Comarum salesovianum] >ARD05051.1 ribosomal protein S7 (plastid) [Kerria japonica] >ARH53651.1 ribosomal protein S7 (chloroplast) [Pyrus pashia] >ARH53652.1 ribosomal protein S7 (chloroplast) [Pyrus pashia] >ARJ61975.1 ribosomal protein S7 (plastid) [Prunus dulcis] >ARJ61976.1 ribosomal protein S7 (plastid) [Prunus dulcis] >ARJ62061.1 ribosomal protein S7 (plastid) [Eriobotrya japonica] >ARJ62062.1 ribosomal protein S7 (plastid) [Eriobotrya japonica] >ARJ62562.1 ribosomal protein S7 (plastid) [Fragaria virginiana] >ARJ62563.1 ribosomal protein S7 (plastid) [Fragaria virginiana] >ASL06417.1 ribosomal protein S7 (chloroplast) [Fragaria nipponica] >ASL06431.1 ribosomal protein S7 (chloroplast) [Fragaria nipponica] >ASL06501.1 ribosomal protein S7 (chloroplast) [Fragaria orientalis] >ASL06515.1 ribosomal protein S7 (chloroplast) [Fragaria orientalis] >ASS18363.1 ribosomal protein S7 (chloroplast) [Malus domestica] >ASS18369.1 ribosomal protein S7 (chloroplast) [Malus domestica] >AST14348.1 ribosomal protein S7 (chloroplast) [Malus florentina] >AST14361.1 ribosomal protein S7 (chloroplast) [Malus florentina] >AST14428.1 ribosomal protein S7 (chloroplast) [Malus trilobata] >AST14441.1 ribosomal protein S7 (chloroplast) [Malus trilobata] >AST14513.1 ribosomal protein S7 (chloroplast) [Malus florentina] >AST14526.1 ribosomal protein S7 (chloroplast) [Malus florentina] >AST14596.1 ribosomal protein S7 (chloroplast) [Malus tschonoskii] >AST14609.1 ribosomal protein S7 (chloroplast) [Malus tschonoskii] >AST14679.1 ribosomal protein S7 (chloroplast) [Malus tschonoskii] >AST14692.1 ribosomal protein S7 (chloroplast) [Malus tschonoskii] >ASU92643.1 ribosomal protein S7 (chloroplast) [Prunus cerasoides] >ASU92656.1 ribosomal protein S7 (chloroplast) [Prunus cerasoides] >ASV64662.1 ribosomal protein S7 (chloroplast) [Prunus humilis] >ASV64675.1 ribosomal protein S7 (chloroplast) [Prunus humilis] >ATU31699.1 ribosomal protein S7 (chloroplast) [Malus micromalus] >ATU31700.1 ribosomal protein S7 (chloroplast) [Malus micromalus] >ATU85460.1 ribosomal protein S7 (plastid) [Prunus tomentosa] >ATU85479.1 ribosomal protein S7 (plastid) [Prunus tomentosa] >ATX68271.1 ribosomal protein S7 (chloroplast) [Dasiphora fruticosa] >ATX68272.1 ribosomal protein S7 (chloroplast) [Dasiphora fruticosa] >AUB30028.1 ribosomal protein S7 (chloroplast) [Pyrus hopeiensis] >AUB30041.1 ribosomal protein S7 (chloroplast) [Pyrus hopeiensis] >AUW55509.1 ribosomal protein S7 (plastid) [Sorbus ulleungensis] >AUW55510.1 ribosomal protein S7 (plastid) [Sorbus ulleungensis] >AVP74996.1 30S ribosomal protein S7 (chloroplast) [Rosa praelucens] >AVP75009.1 30S ribosomal protein S7 (chloroplast) [Rosa praelucens] >AWE09547.1 ribosomal protein S7 (chloroplast) [Prunus mongolica] >AWE09548.1 ribosomal protein S7 (chloroplast) [Prunus mongolica] >AWE09631.1 ribosomal protein S7 (chloroplast) [Prunus pedunculata] >AWE09632.1 ribosomal protein S7 (chloroplast) [Prunus pedunculata] >AWQ64386.1 ribosomal protein S7 (chloroplast) [Rubus takesimensis] >AWQ64399.1 ribosomal protein S7 (chloroplast) [Rubus takesimensis] >AXE43705.1 30S ribosomal protein S7 (chloroplast) [Rosa chinensis var. spontanea] >AXE43718.1 30S ribosomal protein S7 (chloroplast) [Rosa chinensis var. spontanea] >AXG76209.1 ribosomal protein S7 (chloroplast) [Prunus takesimensis] >AXG76222.1 ribosomal protein S7 (chloroplast) [Prunus takesimensis] >AXR91331.1 ribosomal protein S7 (chloroplast) [Malus yunnanensis] >AXR91332.1 ribosomal protein S7 (chloroplast) [Malus yunnanensis] >AXR91415.1 ribosomal protein S7 (chloroplast) [Malus yunnanensis] >AXR91416.1 ribosomal protein S7 (chloroplast) [Malus yunnanensis] >AXR91498.1 ribosomal protein S7 (chloroplast) [Malus yunnanensis] >AXR91499.1 ribosomal protein S7 (chloroplast) [Malus yunnanensis] >AXR91584.1 ribosomal protein S7 (chloroplast) [Malus yunnanensis] >AXR91585.1 ribosomal protein S7 (chloroplast) [Malus yunnanensis]) HSP 1 Score: 163.7 bits (413), Expect = 2.9e-37 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. NCBI nr
Match: YP_762306.1 (ribosomal protein S7 [Morus indica] >YP_762319.1 ribosomal protein S7 [Morus indica] >YP_009110381.1 ribosomal protein S7 (chloroplast) [Morus mongolica] >YP_009110394.1 ribosomal protein S7 (chloroplast) [Morus mongolica] >YP_009139724.1 ribosomal protein S7 (chloroplast) [Morus notabilis] >YP_009139737.1 ribosomal protein S7 (chloroplast) [Morus notabilis] >YP_009170471.1 ribosomal protein S7 (chloroplast) [Humulus lupulus] >YP_009170483.1 ribosomal protein S7 (chloroplast) [Humulus lupulus] >YP_009256373.1 ribosomal protein S7 (chloroplast) [Ziziphus jujuba] >YP_009256385.1 ribosomal protein S7 (chloroplast) [Ziziphus jujuba] >YP_009316827.1 ribosomal protein S7 (plastid) [Morus cathayana] >YP_009316841.1 ribosomal protein S7 (plastid) [Morus cathayana] >YP_009327721.1 ribosomal protein S7 (chloroplast) [Idesia polycarpa] >YP_009327734.1 ribosomal protein S7 (chloroplast) [Idesia polycarpa] >YP_009336076.1 ribosomal protein S7 (chloroplast) [Ulmus davidiana] >YP_009336090.1 ribosomal protein S7 (chloroplast) [Ulmus davidiana] >YP_009336154.1 ribosomal protein S7 (chloroplast) [Ulmus laciniata] >YP_009336168.1 ribosomal protein S7 (chloroplast) [Ulmus laciniata] >YP_009336232.1 ribosomal protein S7 (chloroplast) [Ulmus macrocarpa] >YP_009336246.1 ribosomal protein S7 (chloroplast) [Ulmus macrocarpa] >YP_009336309.1 ribosomal protein S7 (chloroplast) [Ulmus pumila] >YP_009336323.1 ribosomal protein S7 (chloroplast) [Ulmus pumila] >YP_009349651.1 ribosomal protein S7 (chloroplast) [Ficus religiosa] >YP_009349667.1 ribosomal protein S7 (chloroplast) [Ficus religiosa] >YP_009390601.1 ribosomal protein S7 (chloroplast) [Ficus carica] >YP_009390614.1 ribosomal protein S7 (chloroplast) [Ficus carica] >YP_009413068.1 ribosomal protein S7 (plastid) [Broussonetia papyrifera] >YP_009413086.1 ribosomal protein S7 (plastid) [Broussonetia papyrifera] >YP_009463975.1 ribosomal protein S7 (chloroplast) [Broussonetia kazinoki x Broussonetia papyrifera] >YP_009463988.1 ribosomal protein S7 (chloroplast) [Broussonetia kazinoki x Broussonetia papyrifera] >YP_009467256.1 ribosomal protein S7 (chloroplast) [Ziziphus mauritiana] >YP_009467268.1 ribosomal protein S7 (chloroplast) [Ziziphus mauritiana] >YP_009467352.1 ribosomal protein S7 (chloroplast) [Ziziphus spina-christi] >YP_009467340.1 ribosomal protein S7 (chloroplast) [Ziziphus spina-christi] >YP_009478167.1 ribosomal protein S7 (chloroplast) [Berchemia berchemiifolia] >YP_009478155.1 ribosomal protein S7 (chloroplast) [Berchemia berchemiifolia] >YP_009486171.1 ribosomal protein S7 (chloroplast) [Ulmus chenmoui] >YP_009486185.1 ribosomal protein S7 (chloroplast) [Ulmus chenmoui] >YP_009488552.1 ribosomal protein S7 (chloroplast) [Ulmus gaussenii] >YP_009488566.1 ribosomal protein S7 (chloroplast) [Ulmus gaussenii] >Q09WV9.1 RecName: Full=30S ribosomal protein S7, chloroplastic >ABB21002.1 ribosomal protein S7 (chloroplast) [Morus indica] >ABB21015.1 ribosomal protein S7 (chloroplast) [Morus indica] >ADD29905.1 ribosomal protein S7 (chloroplast) [Ficus sp. Moore 315] >AEK71753.1 ribosomal protein S7 (plastid) [Ficus sp. M. J. Moore 315] >AIX11706.1 ribosomal protein S7 (chloroplast) [Morus mongolica] >AIX11720.1 ribosomal protein S7 (chloroplast) [Morus mongolica] >AKF34074.1 ribosomal protein S7 (chloroplast) [Morus notabilis] >AKF34075.1 ribosomal protein S7 (chloroplast) [Morus notabilis] >ALE29467.1 ribosomal protein S7 (chloroplast) [Humulus lupulus] >ALE29480.1 ribosomal protein S7 (chloroplast) [Humulus lupulus] >AMC32657.1 ribosomal protein S7 (chloroplast) [Ceanothus herbaceus] >AMY59142.1 ribosomal protein S7 (chloroplast) [Morus alba var. multicaulis] >AMY59143.1 ribosomal protein S7 (chloroplast) [Morus alba var. multicaulis] >AND82366.1 ribosomal protein S7 (chloroplast) [Ziziphus jujuba] >AND82379.1 ribosomal protein S7 (chloroplast) [Ziziphus jujuba] >ANE10831.1 ribosomal protein S7 (chloroplast) [Morus alba var. atropurpurea] >ANE10832.1 ribosomal protein S7 (chloroplast) [Morus alba var. atropurpurea] >ANJ78256.1 ribosomal protein S7 (chloroplast) [Ziziphus jujuba] >ANJ78257.1 ribosomal protein S7 (chloroplast) [Ziziphus jujuba] >ANJ78341.1 ribosomal protein S7 (chloroplast) [Ziziphus jujuba var. spinosa] >ANJ78342.1 ribosomal protein S7 (chloroplast) [Ziziphus jujuba var. spinosa] >AOW43724.1 ribosomal protein S7 (plastid) [Morus cathayana] >AOW43738.1 ribosomal protein S7 (plastid) [Morus cathayana] >AOW43809.1 ribosomal protein S7 (plastid) [Morus alba var. multicaulis] >AOW43823.1 ribosomal protein S7 (plastid) [Morus alba var. multicaulis] >APB02910.1 ribosomal protein S7 (chloroplast) [Idesia polycarpa] >APB02923.1 ribosomal protein S7 (chloroplast) [Idesia polycarpa] >APP88896.1 ribosomal protein S7 (chloroplast) [Ulmus davidiana] >APP88910.1 ribosomal protein S7 (chloroplast) [Ulmus davidiana] >APP88974.1 ribosomal protein S7 (chloroplast) [Ulmus davidiana var. japonica] >APP88988.1 ribosomal protein S7 (chloroplast) [Ulmus davidiana var. japonica] >APP89052.1 ribosomal protein S7 (chloroplast) [Ulmus laciniata] >APP89066.1 ribosomal protein S7 (chloroplast) [Ulmus laciniata] >APP89130.1 ribosomal protein S7 (chloroplast) [Ulmus macrocarpa] >APP89144.1 ribosomal protein S7 (chloroplast) [Ulmus macrocarpa] >APP89207.1 ribosomal protein S7 (chloroplast) [Ulmus pumila] >APP89221.1 ribosomal protein S7 (chloroplast) [Ulmus pumila] >AQM39666.1 ribosomal protein S7 (chloroplast) [Ficus religiosa] >AQM39667.1 ribosomal protein S7 (chloroplast) [Ficus religiosa] >ARC97625.1 ribosomal protein S7 (plastid) [Aphananthe aspera] >ARD00102.1 ribosomal protein S7 (plastid) [Ulmus changii var. kunmingensis] >ARD02499.1 ribosomal protein S7 (plastid) [Morus australis] >ARD03658.1 ribosomal protein S7 (plastid) [Ziziphus jujuba] >ARF06064.1 ribosomal protein S7 (plastid) [Broussonetia papyrifera] >ARF06081.1 ribosomal protein S7 (plastid) [Broussonetia papyrifera] >ART88715.1 ribosomal protein S7 (chloroplast) [Berchemiella wilsonii var. wilsonii] >ART88728.1 ribosomal protein S7 (chloroplast) [Berchemiella wilsonii var. wilsonii] >ARU81178.1 ribosomal protein S7 (chloroplast) [Ziziphus mauritiana] >ARU81179.1 ribosomal protein S7 (chloroplast) [Ziziphus mauritiana] >ARU81262.1 ribosomal protein S7 (chloroplast) [Ziziphus spina-christi] >ARU81263.1 ribosomal protein S7 (chloroplast) [Ziziphus spina-christi] >ARV87064.1 ribosomal protein S7 (chloroplast) [Ficus carica] >ARV87078.1 ribosomal protein S7 (chloroplast) [Ficus carica] >ASR92700.1 ribosomal protein S7 (chloroplast) [Chaetachme aristata] >ASR92768.1 ribosomal protein S7 (chloroplast) [Gironniera celtidifolia] >AUH21175.1 ribosomal protein S7 (chloroplast) [Ziziphus jujuba] >AUH21188.1 ribosomal protein S7 (chloroplast) [Ziziphus jujuba] >AUW55429.1 ribosomal protein S7 (chloroplast) [Broussonetia kazinoki x Broussonetia papyrifera] >AUW55442.1 ribosomal protein S7 (chloroplast) [Broussonetia kazinoki x Broussonetia papyrifera] >AVP32498.1 ribosomal protein S7 (chloroplast) [Berchemia berchemiifolia] >AVP32499.1 ribosomal protein S7 (chloroplast) [Berchemia berchemiifolia] >AVY51918.1 ribosomal protein S7 (chloroplast) [Humulus lupulus] >AVY51930.1 ribosomal protein S7 (chloroplast) [Humulus lupulus] >AWB12211.1 ribosomal protein S7 (chloroplast) [Ulmus chenmoui] >AWB12212.1 ribosomal protein S7 (chloroplast) [Ulmus chenmoui] >AWD77215.1 ribosomal protein S7 (chloroplast) [Ulmus gaussenii] >AWD77216.1 ribosomal protein S7 (chloroplast) [Ulmus gaussenii]) HSP 1 Score: 163.7 bits (413), Expect = 2.9e-37 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi04M000088 vs. NCBI nr
Match: YP_009443107.1 (ribosomal protein S7 (chloroplast) [Garcinia mangostana] >YP_009443119.1 ribosomal protein S7 (chloroplast) [Garcinia mangostana] >AEK71593.1 ribosomal protein S7 (plastid) [Terminalia catappa] >APS85721.1 ribosomal protein S7 (chloroplast) [Garcinia mangostana] >APS85733.1 ribosomal protein S7 (chloroplast) [Garcinia mangostana]) HSP 1 Score: 163.7 bits (413), Expect = 2.9e-37 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
|