Bhi02M001199 (mRNA) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTAATTGTTTTTGTAATTCAGGTGCAATAGCAACATATCTTAGATTCTTTCCCAAGTTGAAGGCCAGATATGATTATGGGCTTTTGATATTCATCTTGACATTTGATATGGTGGCTGTGTCTGGTTATAGAGATGATGAGATATTGAAACTTGCTTGGCATAGGCTTGCAAACATTCTCATGGGTGGTTTTATTGCAGTGGTTGTTTGCATCTTTGTTAGGCCTGTTTGGGCTGGTGCTGATCTTCACCAATTGGTTTCTACCGACATTGAAAACCTTGGGAGTTTCTTTGAAGGTGATAATCTTGATCTTTACCAGAAAAAAAAAAATTGTATCGATGTGATTTTATGA ATGTTTAATTGTTTTTGTAATTCAGGTGCAATAGCAACATATCTTAGATTCTTTCCCAAGTTGAAGGCCAGATATGATTATGGGCTTTTGATATTCATCTTGACATTTGATATGGTGGCTGTGTCTGGTTATAGAGATGATGAGATATTGAAACTTGCTTGGCATAGGCTTGCAAACATTCTCATGGGTGGTTTTATTGCAGTGGTTGTTTGCATCTTTGTTAGGCCTGTTTGGGCTGGTGCTGATCTTCACCAATTGGTTTCTACCGACATTGAAAACCTTGGGAGTTTCTTTGAAGGTGATAATCTTGATCTTTACCAGAAAAAAAAAAATTGTATCGATGTGATTTTATGA ATGTTTAATTGTTTTTGTAATTCAGGTGCAATAGCAACATATCTTAGATTCTTTCCCAAGTTGAAGGCCAGATATGATTATGGGCTTTTGATATTCATCTTGACATTTGATATGGTGGCTGTGTCTGGTTATAGAGATGATGAGATATTGAAACTTGCTTGGCATAGGCTTGCAAACATTCTCATGGGTGGTTTTATTGCAGTGGTTGTTTGCATCTTTGTTAGGCCTGTTTGGGCTGGTGCTGATCTTCACCAATTGGTTTCTACCGACATTGAAAACCTTGGGAGTTTCTTTGAAGGTGATAATCTTGATCTTTACCAGAAAAAAAAAAATTGTATCGATGTGATTTTATGA MFNCFCNSGAIATYLRFFPKLKARYDYGLLIFILTFDMVAVSGYRDDEILKLAWHRLANILMGGFIAVVVCIFVRPVWAGADLHQLVSTDIENLGSFFEGDNLDLYQKKKNCIDVIL
BLAST of Bhi02M001199 vs. Swiss-Prot
Match: sp|Q9SRM9|ALMT8_ARATH (Aluminum-activated malate transporter 8 OS=Arabidopsis thaliana OX=3702 GN=ALMT8 PE=3 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.9e-27 Identity = 56/102 (54.90%), Postives = 76/102 (74.51%), Query Frame = 0
BLAST of Bhi02M001199 vs. Swiss-Prot
Match: sp|Q9SJE8|ALMT2_ARATH (Aluminum-activated malate transporter 2 OS=Arabidopsis thaliana OX=3702 GN=ALMT2 PE=2 SV=2) HSP 1 Score: 114.8 bits (286), Expect = 6.6e-25 Identity = 50/90 (55.56%), Postives = 73/90 (81.11%), Query Frame = 0
BLAST of Bhi02M001199 vs. Swiss-Prot
Match: sp|Q9XIN1|ALMT7_ARATH (Aluminum-activated malate transporter 7 OS=Arabidopsis thaliana OX=3702 GN=ALMT7 PE=3 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.1e-24 Identity = 48/107 (44.86%), Postives = 78/107 (72.90%), Query Frame = 0
BLAST of Bhi02M001199 vs. Swiss-Prot
Match: sp|Q9SJE9|ALMT1_ARATH (Aluminum-activated malate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ALMT1 PE=1 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 8.9e-22 Identity = 43/90 (47.78%), Postives = 71/90 (78.89%), Query Frame = 0
BLAST of Bhi02M001199 vs. Swiss-Prot
Match: sp|Q76LB1|ALMT1_WHEAT (Aluminum-activated malate transporter 1 OS=Triticum aestivum OX=4565 GN=ALMT1 PE=1 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 4.4e-21 Identity = 46/89 (51.69%), Postives = 65/89 (73.03%), Query Frame = 0
BLAST of Bhi02M001199 vs. TAIR10
Match: AT3G11680.1 (Aluminium activated malate transporter family protein) HSP 1 Score: 123.2 bits (308), Expect = 1.0e-28 Identity = 56/102 (54.90%), Postives = 76/102 (74.51%), Query Frame = 0
BLAST of Bhi02M001199 vs. TAIR10
Match: AT1G08440.1 (Aluminium activated malate transporter family protein) HSP 1 Score: 114.8 bits (286), Expect = 3.7e-26 Identity = 50/90 (55.56%), Postives = 73/90 (81.11%), Query Frame = 0
BLAST of Bhi02M001199 vs. TAIR10
Match: AT2G27240.1 (Aluminium activated malate transporter family protein) HSP 1 Score: 114.0 bits (284), Expect = 6.2e-26 Identity = 48/107 (44.86%), Postives = 78/107 (72.90%), Query Frame = 0
BLAST of Bhi02M001199 vs. TAIR10
Match: AT1G08430.1 (aluminum-activated malate transporter 1) HSP 1 Score: 104.4 bits (259), Expect = 4.9e-23 Identity = 43/90 (47.78%), Postives = 71/90 (78.89%), Query Frame = 0
BLAST of Bhi02M001199 vs. TAIR10
Match: AT4G00910.1 (Aluminium activated malate transporter family protein) HSP 1 Score: 97.1 bits (240), Expect = 7.9e-21 Identity = 41/89 (46.07%), Postives = 63/89 (70.79%), Query Frame = 0
BLAST of Bhi02M001199 vs. TrEMBL
Match: tr|A0A0A0LXK8|A0A0A0LXK8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G630840 PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 2.2e-41 Identity = 85/94 (90.43%), Postives = 90/94 (95.74%), Query Frame = 0
BLAST of Bhi02M001199 vs. TrEMBL
Match: tr|A0A2G9GZF5|A0A2G9GZF5_9LAMI (Uncharacterized protein OS=Handroanthus impetiginosus OX=429701 GN=CDL12_16769 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 3.6e-28 Identity = 61/91 (67.03%), Postives = 75/91 (82.42%), Query Frame = 0
BLAST of Bhi02M001199 vs. TrEMBL
Match: tr|A0A2G9I617|A0A2G9I617_9LAMI (Uncharacterized protein OS=Handroanthus impetiginosus OX=429701 GN=CDL12_02059 PE=4 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 1.1e-27 Identity = 56/98 (57.14%), Postives = 81/98 (82.65%), Query Frame = 0
BLAST of Bhi02M001199 vs. TrEMBL
Match: tr|A0A2G9GZE7|A0A2G9GZE7_9LAMI (Putative membrane protein OS=Handroanthus impetiginosus OX=429701 GN=CDL12_16770 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 1.4e-27 Identity = 59/98 (60.20%), Postives = 78/98 (79.59%), Query Frame = 0
BLAST of Bhi02M001199 vs. TrEMBL
Match: tr|A0A2G9FYL2|A0A2G9FYL2_9LAMI (Putative membrane protein OS=Handroanthus impetiginosus OX=429701 GN=CDL12_29380 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 1.4e-27 Identity = 59/99 (59.60%), Postives = 79/99 (79.80%), Query Frame = 0
BLAST of Bhi02M001199 vs. NCBI nr
Match: KGN66580.1 (hypothetical protein Csa_1G630840 [Cucumis sativus]) HSP 1 Score: 177.2 bits (448), Expect = 3.3e-41 Identity = 85/94 (90.43%), Postives = 90/94 (95.74%), Query Frame = 0
BLAST of Bhi02M001199 vs. NCBI nr
Match: XP_004139137.1 (PREDICTED: aluminum-activated malate transporter 2 [Cucumis sativus]) HSP 1 Score: 175.6 bits (444), Expect = 9.6e-41 Identity = 84/89 (94.38%), Postives = 87/89 (97.75%), Query Frame = 0
BLAST of Bhi02M001199 vs. NCBI nr
Match: XP_023530353.1 (aluminum-activated malate transporter 2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 163.3 bits (412), Expect = 4.9e-37 Identity = 76/95 (80.00%), Postives = 88/95 (92.63%), Query Frame = 0
BLAST of Bhi02M001199 vs. NCBI nr
Match: XP_023003150.1 (aluminum-activated malate transporter 2-like [Cucurbita maxima]) HSP 1 Score: 162.5 bits (410), Expect = 8.4e-37 Identity = 75/97 (77.32%), Postives = 88/97 (90.72%), Query Frame = 0
BLAST of Bhi02M001199 vs. NCBI nr
Match: XP_022153250.1 (aluminum-activated malate transporter 2-like [Momordica charantia]) HSP 1 Score: 161.4 bits (407), Expect = 1.9e-36 Identity = 74/101 (73.27%), Postives = 86/101 (85.15%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
|