MELO3C035541.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGCCAATGGGTCCTGGAAAGATTCGTTCATCATATAAAGGAGCCTTATAAAACATTTCAACCTGTGCAAACGCTCCTAATTGGTGCAACTGTTGTTTCTGCGGCCACCATCGGTATCCCTTCTACTTTACAGATATGTATTCTTCTCGCCAGTCTCGCACTTGCAAGCGTCGTCTTTGCTTACGCTTTGTTTGAACTCCAAAACAATTTTGTTAACTGA ATGTGCCAATGGGTCCTGGAAAGATTCGTTCATCATATAAAGGAGCCTTATAAAACATTTCAACCTGTGCAAACGCTCCTAATTGGTGCAACTGTTGTTTCTGCGGCCACCATCGGTATCCCTTCTACTTTACAGATATGTATTCTTCTCGCCAGTCTCGCACTTGCAAGCGTCGTCTTTGCTTACGCTTTGTTTGAACTCCAAAACAATTTTGTTAACTGA ATGTGCCAATGGGTCCTGGAAAGATTCGTTCATCATATAAAGGAGCCTTATAAAACATTTCAACCTGTGCAAACGCTCCTAATTGGTGCAACTGTTGTTTCTGCGGCCACCATCGGTATCCCTTCTACTTTACAGATATGTATTCTTCTCGCCAGTCTCGCACTTGCAAGCGTCGTCTTTGCTTACGCTTTGTTTGAACTCCAAAACAATTTTGTTAACTGA MCQWVLERFVHHIKEPYKTFQPVQTLLIGATVVSAATIGIPSTLQICILLASLALASVVFAYALFELQNNFVN
BLAST of MELO3C035541.2 vs. NCBI nr
Match: XP_011654100.1 (PREDICTED: LOW QUALITY PROTEIN: pheophorbide a oxygenase, chloroplastic [Cucumis sativus]) HSP 1 Score: 80.1 bits (196), Expect = 3.4e-12 Identity = 51/74 (68.92%), Postives = 53/74 (71.62%), Query Frame = 0
BLAST of MELO3C035541.2 vs. NCBI nr
Match: XP_008462467.1 (PREDICTED: pheophorbide a oxygenase, chloroplastic [Cucumis melo]) HSP 1 Score: 79.0 bits (193), Expect = 7.6e-12 Identity = 49/74 (66.22%), Postives = 54/74 (72.97%), Query Frame = 0
BLAST of MELO3C035541.2 vs. NCBI nr
Match: XP_022152935.1 (pheophorbide a oxygenase, chloroplastic [Momordica charantia]) HSP 1 Score: 76.3 bits (186), Expect = 5.0e-11 Identity = 47/74 (63.51%), Postives = 53/74 (71.62%), Query Frame = 0
BLAST of MELO3C035541.2 vs. NCBI nr
Match: XP_023519435.1 (pheophorbide a oxygenase, chloroplastic [Cucurbita pepo subsp. pepo]) HSP 1 Score: 75.5 bits (184), Expect = 8.5e-11 Identity = 47/74 (63.51%), Postives = 53/74 (71.62%), Query Frame = 0
BLAST of MELO3C035541.2 vs. NCBI nr
Match: XP_022964963.1 (pheophorbide a oxygenase, chloroplastic [Cucurbita moschata]) HSP 1 Score: 73.9 bits (180), Expect = 2.5e-10 Identity = 46/74 (62.16%), Postives = 52/74 (70.27%), Query Frame = 0
BLAST of MELO3C035541.2 vs. TAIR10
Match: AT3G44880.1 (Pheophorbide a oxygenase family protein with Rieske [2Fe-2S] domain) HSP 1 Score: 54.3 bits (129), Expect = 3.7e-08 Identity = 34/74 (45.95%), Postives = 46/74 (62.16%), Query Frame = 0
BLAST of MELO3C035541.2 vs. Swiss-Prot
Match: sp|Q9FYC2|PAO_ARATH (Pheophorbide a oxygenase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PAO PE=1 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 6.6e-07 Identity = 34/74 (45.95%), Postives = 46/74 (62.16%), Query Frame = 0
BLAST of MELO3C035541.2 vs. TrEMBL
Match: tr|A0A1S3CII7|A0A1S3CII7_CUCME (pheophorbide a oxygenase, chloroplastic OS=Cucumis melo OX=3656 GN=LOC103500813 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 5.1e-12 Identity = 49/74 (66.22%), Postives = 54/74 (72.97%), Query Frame = 0
BLAST of MELO3C035541.2 vs. TrEMBL
Match: tr|A0A067FAT0|A0A067FAT0_CITSI (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g009165mg PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.9e-07 Identity = 42/77 (54.55%), Postives = 46/77 (59.74%), Query Frame = 0
BLAST of MELO3C035541.2 vs. TrEMBL
Match: tr|M5WRF3|M5WRF3_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica OX=3760 GN=PRUPE_ppa019738mg PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 3.8e-07 Identity = 40/74 (54.05%), Postives = 46/74 (62.16%), Query Frame = 0
BLAST of MELO3C035541.2 vs. TrEMBL
Match: tr|A0A251NNR8|A0A251NNR8_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_6G113600 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 3.8e-07 Identity = 40/74 (54.05%), Postives = 46/74 (62.16%), Query Frame = 0
BLAST of MELO3C035541.2 vs. TrEMBL
Match: tr|A0A2G5DJX8|A0A2G5DJX8_AQUCA (Uncharacterized protein OS=Aquilegia coerulea OX=218851 GN=AQUCO_01900165v1 PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 4.9e-07 Identity = 39/74 (52.70%), Postives = 47/74 (63.51%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|