MELO3C035424.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGACGAATGTTGACACTAACGGAACATCTTCACTTCAAAATGTGACTCTCTAAGTGAATACAAAGGGTCATGTGCTTTATGCTTTCGTTAATAAAAGATACATTGGGTCGCAATGGGAGAGAAATGACCTGAGTTTTGTGTTTGAGAAACCTATGAGAAACCCATTCTACTAAAATCGAGAACCAACACAATAACTCTTTTGACTGCCACAATTGGGTTGAAGAATTACGACGCATTTTATGTTATAGTGTCAACGGGAATAGATGGAGGTCTTATCTATCTAATTGGAGATGGAAACACGAAAACTGATCTATCATCAAATTTATGGTCTTATAAGGTTGGATTAAATGGAGAAATGAAACAAATTTACAACCCAATGTTCTCACAGAGAACAAATTGGATTGCACTAAATCAAAAGTCTATTGGAAGGCGAATGATATGGTACATGGCTAGCTTTAAGACACCTGCTGGAATTGACCCAGTAGTCTTGGACATGCAAGGAATGGGAAAAGGCCAAGCTTGGGTAAATGGGCAAAGCATAG ATGACGAATGTTGACACTAACGGAACATCTTCACTTCAAAATGTGACTCTCTAAGTGAATACAAAGGGTCATGTGCTTTATGCTTTCGTTAATAAAAGATACATTGGGTCGCAATGGGAGAGAAATGACCTGAGTTTTGTGTTTGAGAAACCTATGAGAAACCCATTCTACTAAAATCGAGAACCAACACAATAACTCTTTTGACTGCCACAATTGGGTTGAAGAATTACGACGCATTTTATGTTATAGTGTCAACGGGAATAGATGGAgGTCTTATCTATCTAATTGGAGATGGAAACACGAAAACTGATCTATCATCAAATTTATGGTCTTATAAGGTTGGATTAAATGGAGAAATGAAACAAATTTACAACCCAATGTTCTCACAGAGAACAAATTGGATTGCACTAAATCAAAAGTCTATTGGAAGGCGAATGATATGGTACATGGCTAGCTTTAAGACACCTGCTGGAATTGACCCAGTAGTCTTGGACATGCAAGGAATGGGAAAAGGCCAAGCTTGGGTAAATGGGCAAAGCATAG ATGAAACAAATTTACAACCCAATGTTCTCACAGAGAACAAATTGGATTGCACTAAATCAAAAGTCTATTGGAAGGCGAATGATATGGTACATGGCTAGCTTTAAGACACCTGCTGGAATTGACCCAGTAGTCTTGGACATGCAAGGAATGGGAAAAGGCCAAGCTTGGGTAAATGGGCAAAGCATA MKQIYNPMFSQRTNWIALNQKSIGRRMIWYMASFKTPAGIDPVVLDMQGMGKGQAWVNGQSI
BLAST of MELO3C035424.2 vs. NCBI nr
Match: XP_008437703.1 (PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis melo]) HSP 1 Score: 126.7 bits (317), Expect = 2.7e-26 Identity = 58/62 (93.55%), Postives = 59/62 (95.16%), Query Frame = 0
BLAST of MELO3C035424.2 vs. NCBI nr
Match: XP_008465565.1 (PREDICTED: beta-galactosidase 7-like, partial [Cucumis melo]) HSP 1 Score: 126.7 bits (317), Expect = 2.7e-26 Identity = 58/62 (93.55%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C035424.2 vs. NCBI nr
Match: XP_011648551.1 (PREDICTED: beta-galactosidase 15-like [Cucumis sativus] >KGN66624.1 hypothetical protein Csa_1G650110 [Cucumis sativus]) HSP 1 Score: 126.3 bits (316), Expect = 3.5e-26 Identity = 58/62 (93.55%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C035424.2 vs. NCBI nr
Match: XP_008437707.1 (PREDICTED: beta-galactosidase 7-like, partial [Cucumis melo]) HSP 1 Score: 124.0 bits (310), Expect = 1.8e-25 Identity = 56/62 (90.32%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C035424.2 vs. NCBI nr
Match: XP_008452141.1 (PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis melo]) HSP 1 Score: 123.6 bits (309), Expect = 2.3e-25 Identity = 57/62 (91.94%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C035424.2 vs. TAIR10
Match: AT5G20710.1 (beta-galactosidase 7) HSP 1 Score: 62.4 bits (150), Expect = 1.1e-10 Identity = 23/39 (58.97%), Postives = 31/39 (79.49%), Query Frame = 0
BLAST of MELO3C035424.2 vs. TAIR10
Match: AT2G32810.1 (beta galactosidase 9) HSP 1 Score: 61.6 bits (148), Expect = 1.9e-10 Identity = 26/60 (43.33%), Postives = 36/60 (60.00%), Query Frame = 0
BLAST of MELO3C035424.2 vs. TAIR10
Match: AT1G77410.1 (beta-galactosidase 16) HSP 1 Score: 58.9 bits (141), Expect = 1.3e-09 Identity = 28/59 (47.46%), Postives = 36/59 (61.02%), Query Frame = 0
BLAST of MELO3C035424.2 vs. TAIR10
Match: AT2G28470.1 (beta-galactosidase 8) HSP 1 Score: 56.6 bits (135), Expect = 6.3e-09 Identity = 22/50 (44.00%), Postives = 32/50 (64.00%), Query Frame = 0
BLAST of MELO3C035424.2 vs. TAIR10
Match: AT1G45130.1 (beta-galactosidase 5) HSP 1 Score: 55.8 bits (133), Expect = 1.1e-08 Identity = 25/60 (41.67%), Postives = 36/60 (60.00%), Query Frame = 0
BLAST of MELO3C035424.2 vs. Swiss-Prot
Match: sp|Q10NX8|BGAL6_ORYSJ (Beta-galactosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0255100 PE=1 SV=2) HSP 1 Score: 66.6 bits (161), Expect = 1.1e-10 Identity = 29/59 (49.15%), Postives = 36/59 (61.02%), Query Frame = 0
BLAST of MELO3C035424.2 vs. Swiss-Prot
Match: sp|Q9SCV5|BGAL7_ARATH (Beta-galactosidase 7 OS=Arabidopsis thaliana OX=3702 GN=BGAL7 PE=2 SV=2) HSP 1 Score: 62.4 bits (150), Expect = 2.1e-09 Identity = 23/39 (58.97%), Postives = 31/39 (79.49%), Query Frame = 0
BLAST of MELO3C035424.2 vs. Swiss-Prot
Match: sp|Q9SCV3|BGAL9_ARATH (Beta-galactosidase 9 OS=Arabidopsis thaliana OX=3702 GN=BGAL9 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 3.5e-09 Identity = 26/60 (43.33%), Postives = 36/60 (60.00%), Query Frame = 0
BLAST of MELO3C035424.2 vs. Swiss-Prot
Match: sp|Q00662|BGAL_DIACA (Putative beta-galactosidase OS=Dianthus caryophyllus OX=3570 GN=CARSR12 PE=2 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.0e-08 Identity = 26/61 (42.62%), Postives = 36/61 (59.02%), Query Frame = 0
BLAST of MELO3C035424.2 vs. Swiss-Prot
Match: sp|P49676|BGAL_BRAOL (Beta-galactosidase OS=Brassica oleracea OX=3712 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.3e-08 Identity = 22/38 (57.89%), Postives = 30/38 (78.95%), Query Frame = 0
BLAST of MELO3C035424.2 vs. TrEMBL
Match: tr|A0A1S3AV92|A0A1S3AV92_CUCME (Beta-galactosidase OS=Cucumis melo OX=3656 GN=LOC103483048 PE=3 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.8e-26 Identity = 58/62 (93.55%), Postives = 59/62 (95.16%), Query Frame = 0
BLAST of MELO3C035424.2 vs. TrEMBL
Match: tr|A0A1S3CP60|A0A1S3CP60_CUCME (beta-galactosidase 7-like OS=Cucumis melo OX=3656 GN=LOC103503198 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.8e-26 Identity = 58/62 (93.55%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C035424.2 vs. TrEMBL
Match: tr|A0A0A0M006|A0A0A0M006_CUCSA (Beta-galactosidase OS=Cucumis sativus OX=3659 GN=Csa_1G650110 PE=3 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 2.3e-26 Identity = 58/62 (93.55%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C035424.2 vs. TrEMBL
Match: tr|A0A1S3AUN1|A0A1S3AUN1_CUCME (Beta-galactosidase OS=Cucumis melo OX=3656 GN=LOC103483052 PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.2e-25 Identity = 56/62 (90.32%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C035424.2 vs. TrEMBL
Match: tr|A0A1S3BT39|A0A1S3BT39_CUCME (Beta-galactosidase OS=Cucumis melo OX=3656 GN=LOC103493239 PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 1.5e-25 Identity = 57/62 (91.94%), Postives = 58/62 (93.55%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|