MELO3C035404.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCTCATCTACTTGTTTTATCGATGCATGTAACTAATTTTTAATAATATTGAATTGTTGTTCTGTATTGTCTTTTAGTGTGGATTACATCATCTTAACAAGTGTAGACCGTGATGATATTCATAATGGAGGAAGTGGGCATTTTGCTCAAACAGTTAAAGCAATGAAGGTTGAATAGATTTTTATACAATAATTTTTGTCTCCTTATTGATAAACTGAATTGTTGAAGGTTTCTTGGAAAAGTTACTAGAAGTCTAATTAGTCTTAGTGAATTTATTACGTAGGAACTTAAGCCTGAGATAATGGTTGAATGCTTAACTTTTGATTTCCGAGGTAACTTAAAGGCTGTGGAGACTCTTGTTCACTCAGGGTTAGATGTATTTGCTCACAATATTGAGACTGTGAAACGACTTTAAAGAATTGTTAGAGATCCTTGAGCTGGGTAA ATGTTCTCATCTACTTGTTTTATCGATGCATTGTGGATTACATCATCTTAACAAGTGTAGACCGTGATGATATTCATAATGGAGGAAGTGGGCATTTTGCTCAAACAGTTAAAGCAATGAAGGAACTTAAGCCTGAGATAATGGTTGAATGCTTAACTTTTGATTTCCGAGGTAACTTAAAGGCTGTGGAGACTCTTGTTCACTCAGGGTTAGATGTATTTGCTCACAATATTGAGACTGTGAAACGACTTTAAAGAATTGTTAGAGATCCTTGAGCTGGGTAA GTTCTCATCTACTTGTTTTATCGATGCATTGTGGATTACATCATCTTAACAAGTGTAGACCGTGATGATATTCATAATGGAGGAAGTGGGCATTTTGCTCAAACAGTTAAAGCAATGAAGGAACTTAAGCCTGAGATAATGGTTGAATGCTTAACTTTTGATTTCCGAGGTAACTTAAAGGCTGTGGAGACTCTTGTTCACTCAGGGTTAGATGTATTTGCTCACAATATTGAGACTGTGAAACGACTTTAA VLIYLFYRCIVDYIILTSVDRDDIHNGGSGHFAQTVKAMKELKPEIMVECLTFDFRGNLKAVETLVHSGLDVFAHNIETVKRL
BLAST of MELO3C035404.2 vs. NCBI nr
Match: XP_008445908.1 (PREDICTED: lipoyl synthase, chloroplastic [Cucumis melo]) HSP 1 Score: 141.0 bits (354), Expect = 1.9e-30 Identity = 68/73 (93.15%), Postives = 71/73 (97.26%), Query Frame = 0
BLAST of MELO3C035404.2 vs. NCBI nr
Match: XP_004147097.1 (PREDICTED: lipoyl synthase, chloroplastic [Cucumis sativus] >KGN51575.1 hypothetical protein Csa_5G579610 [Cucumis sativus]) HSP 1 Score: 140.6 bits (353), Expect = 2.4e-30 Identity = 67/73 (91.78%), Postives = 71/73 (97.26%), Query Frame = 0
BLAST of MELO3C035404.2 vs. NCBI nr
Match: XP_022945153.1 (lipoyl synthase, chloroplastic [Cucurbita moschata]) HSP 1 Score: 140.6 bits (353), Expect = 2.4e-30 Identity = 67/73 (91.78%), Postives = 71/73 (97.26%), Query Frame = 0
BLAST of MELO3C035404.2 vs. NCBI nr
Match: XP_022966979.1 (lipoyl synthase, chloroplastic [Cucurbita maxima]) HSP 1 Score: 140.6 bits (353), Expect = 2.4e-30 Identity = 67/73 (91.78%), Postives = 71/73 (97.26%), Query Frame = 0
BLAST of MELO3C035404.2 vs. NCBI nr
Match: XP_023541459.1 (lipoyl synthase, chloroplastic [Cucurbita pepo subsp. pepo]) HSP 1 Score: 140.6 bits (353), Expect = 2.4e-30 Identity = 67/73 (91.78%), Postives = 71/73 (97.26%), Query Frame = 0
BLAST of MELO3C035404.2 vs. TAIR10
Match: AT5G08415.1 (Radical SAM superfamily protein) HSP 1 Score: 131.0 bits (328), Expect = 3.5e-31 Identity = 60/73 (82.19%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of MELO3C035404.2 vs. TAIR10
Match: AT2G20860.1 (lipoic acid synthase 1) HSP 1 Score: 95.9 bits (237), Expect = 1.2e-20 Identity = 44/73 (60.27%), Postives = 58/73 (79.45%), Query Frame = 0
BLAST of MELO3C035404.2 vs. Swiss-Prot
Match: sp|B9N2B0|LISC2_POPTR (Lipoyl synthase 2, chloroplastic OS=Populus trichocarpa OX=3694 GN=LIP1P-2 PE=3 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 8.8e-32 Identity = 63/73 (86.30%), Postives = 71/73 (97.26%), Query Frame = 0
BLAST of MELO3C035404.2 vs. Swiss-Prot
Match: sp|B9I666|LISC1_POPTR (Lipoyl synthase 1, chloroplastic OS=Populus trichocarpa OX=3694 GN=LIP1P-1 PE=3 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.1e-31 Identity = 63/73 (86.30%), Postives = 71/73 (97.26%), Query Frame = 0
BLAST of MELO3C035404.2 vs. Swiss-Prot
Match: sp|B9RX57|LISC_RICCO (Lipoyl synthase, chloroplastic OS=Ricinus communis OX=3988 GN=LIP1P PE=3 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.3e-30 Identity = 62/73 (84.93%), Postives = 71/73 (97.26%), Query Frame = 0
BLAST of MELO3C035404.2 vs. Swiss-Prot
Match: sp|Q8LEE8|LISC_ARATH (Lipoyl synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LIP1P PE=1 SV=2) HSP 1 Score: 131.0 bits (328), Expect = 6.3e-30 Identity = 60/73 (82.19%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of MELO3C035404.2 vs. Swiss-Prot
Match: sp|B8B016|LISC2_ORYSI (Lipoyl synthase 2, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=LIP1P-2 PE=3 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 5.0e-27 Identity = 56/73 (76.71%), Postives = 66/73 (90.41%), Query Frame = 0
BLAST of MELO3C035404.2 vs. TrEMBL
Match: tr|A0A1S3BDA7|A0A1S3BDA7_CUCME (Lipoyl synthase, chloroplastic OS=Cucumis melo OX=3656 GN=LOC103488790 PE=3 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 1.2e-30 Identity = 68/73 (93.15%), Postives = 71/73 (97.26%), Query Frame = 0
BLAST of MELO3C035404.2 vs. TrEMBL
Match: tr|A0A0A0KPN0|A0A0A0KPN0_CUCSA (Lipoyl synthase, chloroplastic OS=Cucumis sativus OX=3659 GN=LIP1P PE=3 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 1.6e-30 Identity = 67/73 (91.78%), Postives = 71/73 (97.26%), Query Frame = 0
BLAST of MELO3C035404.2 vs. TrEMBL
Match: tr|A0A151TQ25|A0A151TQ25_CAJCA (Lipoyl synthase, chloroplastic OS=Cajanus cajan OX=3821 GN=LIP1P PE=3 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 4.7e-30 Identity = 67/73 (91.78%), Postives = 70/73 (95.89%), Query Frame = 0
BLAST of MELO3C035404.2 vs. TrEMBL
Match: tr|A0A2I4EGG5|A0A2I4EGG5_9ROSI (Lipoyl synthase, chloroplastic OS=Juglans regia OX=51240 GN=LOC108989379 PE=3 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 6.1e-30 Identity = 66/73 (90.41%), Postives = 71/73 (97.26%), Query Frame = 0
BLAST of MELO3C035404.2 vs. TrEMBL
Match: tr|A0A2I4H8D0|A0A2I4H8D0_9ROSI (Lipoyl synthase, chloroplastic OS=Juglans regia OX=51240 GN=LOC109014391 PE=3 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 6.1e-30 Identity = 66/73 (90.41%), Postives = 71/73 (97.26%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|