MELO3C035391.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TGGGCAGAAGCAATCGAAAGTTTGGATGATGGAGTCCCAGGATCGGATAAGAGCTTTGGCATGAAGCAAAGGCCAGATGGTGATATTGAAACCGATGAAAAATATTGGGAGCATGATTTCTATATTCCAACCTGCCGAAAGTGCAACGGAGTGCTCAAATC TGGGCAGAAGCAATCGAAAGTTTGGATGATGGAGTCCCAGGATCGGATAAGAGCTTTGGCATGAAGCAAAGGCCAGATGGTGATATTGAAACCGATGAAAAATATTGGGAGCATGATTTCTATATTCCAACCTGCCGAAAGTGCAACGGAGTGCTCAAATC ATGAAGCAAAGGCCAGATGGTGATATTGAAACCGATGAAAAATATTGGGAGCATGATTTCTATATTCCAACCTGCCGAAAGTGCAACGGAGTGCTCAAA MKQRPDGDIETDEKYWEHDFYIPTCRKCNGVLK
BLAST of MELO3C035391.2 vs. NCBI nr
Match: XP_008460860.1 (PREDICTED: NAD-dependent protein deacylase SRT2 isoform X1 [Cucumis melo] >XP_008460861.1 PREDICTED: NAD-dependent protein deacylase SRT2 isoform X1 [Cucumis melo] >XP_008460862.1 PREDICTED: NAD-dependent protein deacylase SRT2 isoform X1 [Cucumis melo]) HSP 1 Score: 74.3 bits (181), Expect = 8.5e-11 Identity = 30/33 (90.91%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of MELO3C035391.2 vs. NCBI nr
Match: XP_016902604.1 (PREDICTED: NAD-dependent protein deacylase SRT2 isoform X2 [Cucumis melo]) HSP 1 Score: 74.3 bits (181), Expect = 8.5e-11 Identity = 30/33 (90.91%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of MELO3C035391.2 vs. NCBI nr
Match: KGN62218.1 (hypothetical protein Csa_2G336650 [Cucumis sativus]) HSP 1 Score: 72.8 bits (177), Expect = 2.5e-10 Identity = 29/33 (87.88%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of MELO3C035391.2 vs. NCBI nr
Match: XP_011649435.1 (PREDICTED: LOW QUALITY PROTEIN: NAD-dependent protein deacetylase SRT2 [Cucumis sativus]) HSP 1 Score: 72.8 bits (177), Expect = 2.5e-10 Identity = 29/33 (87.88%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of MELO3C035391.2 vs. NCBI nr
Match: ESR45349.1 (hypothetical protein CICLE_v10001356mg [Citrus clementina]) HSP 1 Score: 71.2 bits (173), Expect = 7.2e-10 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of MELO3C035391.2 vs. TAIR10
Match: AT5G09230.7 (sirtuin 2) HSP 1 Score: 63.9 bits (154), Expect = 2.1e-11 Identity = 25/33 (75.76%), Postives = 27/33 (81.82%), Query Frame = 0
BLAST of MELO3C035391.2 vs. Swiss-Prot
Match: sp|Q94AQ6|SIR4_ARATH (NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana OX=3702 GN=SRT2 PE=2 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 3.8e-10 Identity = 25/33 (75.76%), Postives = 27/33 (81.82%), Query Frame = 0
BLAST of MELO3C035391.2 vs. TrEMBL
Match: tr|A0A1S3CDW2|A0A1S3CDW2_CUCME (NAD-dependent protein deacylase OS=Cucumis melo OX=3656 GN=LOC103499610 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 5.6e-11 Identity = 30/33 (90.91%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of MELO3C035391.2 vs. TrEMBL
Match: tr|A0A1S4E2Z3|A0A1S4E2Z3_CUCME (NAD-dependent protein deacylase OS=Cucumis melo OX=3656 GN=LOC103499610 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 5.6e-11 Identity = 30/33 (90.91%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of MELO3C035391.2 vs. TrEMBL
Match: tr|A0A0A0LK90|A0A0A0LK90_CUCSA (NAD-dependent protein deacylase OS=Cucumis sativus OX=3659 GN=Csa_2G336650 PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.6e-10 Identity = 29/33 (87.88%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of MELO3C035391.2 vs. TrEMBL
Match: tr|A0A2H5P744|A0A2H5P744_CITUN (NAD-dependent protein deacylase OS=Citrus unshiu OX=55188 GN=CUMW_109820 PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 4.8e-10 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of MELO3C035391.2 vs. TrEMBL
Match: tr|V4SX23|V4SX23_9ROSI (NAD-dependent protein deacylase OS=Citrus clementina OX=85681 GN=CICLE_v10001356mg PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 4.8e-10 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|