MELO3C035377.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideCDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTTCTGAGTAGCCTGGCTGGGATTCAAGAGGGAAAGGATGCGATTGTGGAAGAGGGTGGAATTGTTGCGCTTGTAGAAGCAATTGAAGATGAGTCAGTGAAAGGGAAAGACTTTGCAGTTTTGACACTCTTGTAATTGTGTGTTGAGAGTGTGAGAAATCGAGGGTTGCTCGTCAACGAAGGTGGAATTTCCCCTTTAGTTGCACTTTCTCATACTGGAATCGTTTGAGCAAAGCATAAG ATGCTTCTGAGTAGCCTGGCTGGGATTCAAGAGGGAAAGGATGCGATTGTGGAAGAGGGTGGAATTGTTGCGCTTGTAGAAGCAATTGAAGATGAGTCAGTGAAAGGGAAAGACTTTGCAGTTTTGACACTCTTGTAATTGTGTGTTGAGAGTGTGAGAAATCGAGGGTTGCTCGTCAACGAAGGTGGAATTTCCCCTTTAGTTGCACTTTCTCATACTGGAATCGTTTGAGCAAAGCATAAG ATGCTTCTGAGTAGCCTGGCTGGGATTCAAGAGGGAAAGGATGCGATTGTGGAAGAGGGTGGAATTGTTGCGCTTGTAGAAGCAATTGAAGATGAGTCAGTGAAAGGGAAAGACTTTGCAGTTTTGACACTCTTGTAA MLLSSLAGIQEGKDAIVEEGGIVALVEAIEDESVKGKDFAVLTLL
BLAST of MELO3C035377.2 vs. NCBI nr
Match: XP_008467070.1 (PREDICTED: U-box domain-containing protein 3-like [Cucumis melo]) HSP 1 Score: 75.1 bits (183), Expect = 6.8e-11 Identity = 41/45 (91.11%), Postives = 42/45 (93.33%), Query Frame = 0
BLAST of MELO3C035377.2 vs. NCBI nr
Match: KHN40819.1 (U-box domain-containing protein 2 [Glycine soja]) HSP 1 Score: 73.6 bits (179), Expect = 2.0e-10 Identity = 39/45 (86.67%), Postives = 43/45 (95.56%), Query Frame = 0
BLAST of MELO3C035377.2 vs. NCBI nr
Match: XP_008461972.2 (PREDICTED: tetraspanin-8-like [Cucumis melo]) HSP 1 Score: 67.8 bits (164), Expect = 1.1e-08 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of MELO3C035377.2 vs. NCBI nr
Match: POE71741.1 (u-box domain-containing protein 2 [Quercus suber]) HSP 1 Score: 67.8 bits (164), Expect = 1.1e-08 Identity = 34/45 (75.56%), Postives = 42/45 (93.33%), Query Frame = 0
BLAST of MELO3C035377.2 vs. NCBI nr
Match: KHN42282.1 (U-box domain-containing protein 2 [Glycine soja]) HSP 1 Score: 67.4 bits (163), Expect = 1.4e-08 Identity = 35/45 (77.78%), Postives = 43/45 (95.56%), Query Frame = 0
BLAST of MELO3C035377.2 vs. TAIR10
Match: AT5G67340.1 (ARM repeat superfamily protein) HSP 1 Score: 41.6 bits (96), Expect = 1.5e-04 Identity = 23/45 (51.11%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of MELO3C035377.2 vs. TAIR10
Match: AT3G54790.1 (ARM repeat superfamily protein) HSP 1 Score: 38.9 bits (89), Expect = 9.8e-04 Identity = 21/44 (47.73%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of MELO3C035377.2 vs. TrEMBL
Match: tr|A0A1S3CTY9|A0A1S3CTY9_CUCME (U-box domain-containing protein 3-like OS=Cucumis melo OX=3656 GN=LOC103504507 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.5e-11 Identity = 41/45 (91.11%), Postives = 42/45 (93.33%), Query Frame = 0
BLAST of MELO3C035377.2 vs. TrEMBL
Match: tr|A0A1S3CFT8|A0A1S3CFT8_CUCME (tetraspanin-8-like OS=Cucumis melo OX=3656 GN=LOC103500450 PE=4 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.2e-09 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of MELO3C035377.2 vs. TrEMBL
Match: tr|A0A2P4IT93|A0A2P4IT93_QUESU (U-box domain-containing protein 2 OS=Quercus suber OX=58331 GN=CFP56_31844 PE=4 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.2e-09 Identity = 34/45 (75.56%), Postives = 42/45 (93.33%), Query Frame = 0
BLAST of MELO3C035377.2 vs. TrEMBL
Match: tr|A0A0B2SDD9|A0A0B2SDD9_GLYSO (U-box domain-containing protein 2 OS=Glycine soja OX=3848 GN=glysoja_042030 PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 9.4e-09 Identity = 35/45 (77.78%), Postives = 43/45 (95.56%), Query Frame = 0
BLAST of MELO3C035377.2 vs. TrEMBL
Match: tr|S8D312|S8D312_9LAMI (Uncharacterized protein OS=Genlisea aurea OX=192259 GN=M569_00975 PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.6e-08 Identity = 35/45 (77.78%), Postives = 41/45 (91.11%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|