MELO3C035364.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.AGGTGCCTAAAGGTTGGGATAAGCTATTTGTATGTGTAAGTTTTAAGCAAACTAGGAAGACAATTGTCAAGTCAAGCAAAGCATCGGTTCGTAATGGAAGTTTCCAGTGGACTGAGACTTTATCAGATTCCATTTGGGTTTCACAAGATGAAGTTTCAAAGGAGTTTGAGGATTGTAATTTCAAGCTTGTTGTGGCCATGGTATTGTTGTTTGAGCTTTATGAGTAA AGGTGCCTAAAGGTTGGGATAAGCTATTTGTATGTGTAAGTTTTAAGCAAACTAGGAAGACAATTGTCAAGTCAAGCAAAGCATCGGTTCGTAATGGAAGTTTCCAGTGGACTGAGACTTTATCAGATTCCATTTGGGTTTCACAAGATGAAGTTTCAAAGGAGTTTGAGGATTGTAATTTCAAGCTTGTTGTGGCCATGGTATTGTTGTTTGAGCTTTATGAGTAA GTGCCTAAAGGTTGGGATAAGCTATTTGTATGTGTAAGTTTTAAGCAAACTAGGAAGACAATTGTCAAGTCAAGCAAAGCATCGGTTCGTAATGGAAGTTTCCAGTGGACTGAGACTTTATCAGATTCCATTTGGGTTTCACAAGATGAAGTTTCAAAGGAGTTTGAGGATTGTAATTTCAAGCTTGTTGTGGCCATGGTATTGTTGTTTGAGCTTTATGAGTAA VPKGWDKLFVCVSFKQTRKTIVKSSKASVRNGSFQWTETLSDSIWVSQDEVSKEFEDCNFKLVVAMVLLFELYE
BLAST of MELO3C035364.2 vs. NCBI nr
Match: XP_008442754.1 (PREDICTED: sporulation-specific protein 15-like isoform X1 [Cucumis melo]) HSP 1 Score: 117.5 bits (293), Expect = 2.0e-23 Identity = 57/66 (86.36%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of MELO3C035364.2 vs. NCBI nr
Match: XP_008442755.1 (PREDICTED: sporulation-specific protein 15-like isoform X2 [Cucumis melo]) HSP 1 Score: 117.5 bits (293), Expect = 2.0e-23 Identity = 57/66 (86.36%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of MELO3C035364.2 vs. NCBI nr
Match: XP_008442756.1 (PREDICTED: sporulation-specific protein 15-like isoform X3 [Cucumis melo]) HSP 1 Score: 117.5 bits (293), Expect = 2.0e-23 Identity = 57/66 (86.36%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of MELO3C035364.2 vs. NCBI nr
Match: XP_008442757.1 (PREDICTED: sporulation-specific protein 15-like isoform X4 [Cucumis melo]) HSP 1 Score: 117.5 bits (293), Expect = 2.0e-23 Identity = 57/66 (86.36%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of MELO3C035364.2 vs. NCBI nr
Match: KGN59033.1 (hypothetical protein Csa_3G747640 [Cucumis sativus]) HSP 1 Score: 114.0 bits (284), Expect = 2.2e-22 Identity = 56/66 (84.85%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of MELO3C035364.2 vs. TAIR10
Match: AT1G22060.1 (LOCATED IN: vacuole) HSP 1 Score: 51.2 bits (121), Expect = 3.1e-07 Identity = 24/63 (38.10%), Postives = 41/63 (65.08%), Query Frame = 0
BLAST of MELO3C035364.2 vs. TrEMBL
Match: tr|A0A1S3B5Z1|A0A1S3B5Z1_CUCME (sporulation-specific protein 15-like isoform X4 OS=Cucumis melo OX=3656 GN=LOC103486536 PE=4 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 1.3e-23 Identity = 57/66 (86.36%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of MELO3C035364.2 vs. TrEMBL
Match: tr|A0A1S3B6G6|A0A1S3B6G6_CUCME (sporulation-specific protein 15-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103486536 PE=4 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 1.3e-23 Identity = 57/66 (86.36%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of MELO3C035364.2 vs. TrEMBL
Match: tr|A0A1S3B778|A0A1S3B778_CUCME (sporulation-specific protein 15-like isoform X3 OS=Cucumis melo OX=3656 GN=LOC103486536 PE=4 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 1.3e-23 Identity = 57/66 (86.36%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of MELO3C035364.2 vs. TrEMBL
Match: tr|A0A1S3B751|A0A1S3B751_CUCME (sporulation-specific protein 15-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103486536 PE=4 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 1.3e-23 Identity = 57/66 (86.36%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of MELO3C035364.2 vs. TrEMBL
Match: tr|A0A0A0LB79|A0A0A0LB79_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G747640 PE=4 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.4e-22 Identity = 56/66 (84.85%), Postives = 59/66 (89.39%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|