MELO3C035342.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.CATTTTAACTGCTTGTAAAGATTGGGTTACTAATAGCATTTGTTATAAAGATTTTAGATCAGCTGAAAATGGGTAAAGGTCCAGCAACTGTTAAAACAATTGCTGCTACAATGTCTGTCATTCTCTTGTCTAGTCTTATGAATATTGTTAAGATCCAGAACAAAGGTGCAAAGCTTGAGACAATGTCACCCATTGATCAGGTTCTTTGGAGGACACAGTTGCTTGAGGCTTCACTTATTTGTATGCTCTAG CATTTTAACTGCTTGTAAAGATTGGGTTACTAATAGCATTTGTTATAAAGATTTTAGATCAGCTGAAAATGGGTAAAGGTCCAGCAACTGTTAAAACAATTGCTGCTACAATGTCTGTCATTCTCTTGTCTAGTCTTATGAATATTGTTAAGATCCAGAACAAAGGTGCAAAGCTTGAGACAATGTCACCCATTGATCAGGTTCTTTGGAGGACACAGTTGCTTGAGGCTTCACTTATTTGTATGCTCTAG ATGGGTAAAGGTCCAGCAACTGTTAAAACAATTGCTGCTACAATGTCTGTCATTCTCTTGTCTAGTCTTATGAATATTGTTAAGATCCAGAACAAAGGTGCAAAGCTTGAGACAATGTCACCCATTGATCAGGTTCTTTGGAGGACACAGTTGCTTGAGGCTTCACTTATTTGTATGCTCTAG MGKGPATVKTIAATMSVILLSSLMNIVKIQNKGAKLETMSPIDQVLWRTQLLEASLICML
BLAST of MELO3C035342.2 vs. NCBI nr
Match: XP_004144386.1 (PREDICTED: uncharacterized protein LOC101213598 [Cucumis sativus] >KGN58366.1 hypothetical protein Csa_3G629240 [Cucumis sativus]) HSP 1 Score: 102.4 bits (254), Expect = 5.3e-19 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of MELO3C035342.2 vs. NCBI nr
Match: XP_008460368.1 (PREDICTED: uncharacterized protein LOC103499211 [Cucumis melo]) HSP 1 Score: 102.4 bits (254), Expect = 5.3e-19 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of MELO3C035342.2 vs. NCBI nr
Match: XP_022159831.1 (uncharacterized protein LOC111026135 [Momordica charantia]) HSP 1 Score: 102.4 bits (254), Expect = 5.3e-19 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of MELO3C035342.2 vs. NCBI nr
Match: XP_022995971.1 (uncharacterized protein LOC111491325 [Cucurbita maxima] >XP_023532109.1 uncharacterized protein LOC111794371 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 101.3 bits (251), Expect = 1.2e-18 Identity = 54/57 (94.74%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of MELO3C035342.2 vs. NCBI nr
Match: XP_022930944.1 (uncharacterized protein LOC111437285 [Cucurbita moschata]) HSP 1 Score: 99.8 bits (247), Expect = 3.4e-18 Identity = 53/56 (94.64%), Postives = 55/56 (98.21%), Query Frame = 0
BLAST of MELO3C035342.2 vs. TAIR10
Match: AT5G48660.1 (B-cell receptor-associated protein 31-like ) HSP 1 Score: 93.6 bits (231), Expect = 4.5e-20 Identity = 49/57 (85.96%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of MELO3C035342.2 vs. TAIR10
Match: AT3G07190.1 (B-cell receptor-associated protein 31-like ) HSP 1 Score: 90.9 bits (224), Expect = 2.9e-19 Identity = 47/57 (82.46%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of MELO3C035342.2 vs. TAIR10
Match: AT5G42570.1 (B-cell receptor-associated 31-like) HSP 1 Score: 50.4 bits (119), Expect = 4.3e-07 Identity = 27/56 (48.21%), Postives = 37/56 (66.07%), Query Frame = 0
BLAST of MELO3C035342.2 vs. TAIR10
Match: AT1G11905.1 (B-cell receptor-associated protein 31-like ) HSP 1 Score: 42.4 bits (98), Expect = 1.2e-04 Identity = 19/56 (33.93%), Postives = 40/56 (71.43%), Query Frame = 0
BLAST of MELO3C035342.2 vs. TrEMBL
Match: tr|A0A1S3CBV8|A0A1S3CBV8_CUCME (uncharacterized protein LOC103499211 OS=Cucumis melo OX=3656 GN=LOC103499211 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.5e-19 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of MELO3C035342.2 vs. TrEMBL
Match: tr|A0A0A0LE44|A0A0A0LE44_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G629240 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.5e-19 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of MELO3C035342.2 vs. TrEMBL
Match: tr|A0A151RRL7|A0A151RRL7_CAJCA (Uncharacterized protein OS=Cajanus cajan OX=3821 GN=KK1_033263 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 8.6e-18 Identity = 52/57 (91.23%), Postives = 54/57 (94.74%), Query Frame = 0
BLAST of MELO3C035342.2 vs. TrEMBL
Match: tr|B9S4Z8|B9S4Z8_RICCO (Bcr-associated protein, bap, putative OS=Ricinus communis OX=3988 GN=RCOM_1719170 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.5e-17 Identity = 51/57 (89.47%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of MELO3C035342.2 vs. TrEMBL
Match: tr|A0A0B0NB26|A0A0B0NB26_GOSAR (Uncharacterized protein OS=Gossypium arboreum OX=29729 GN=F383_09194 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.5e-17 Identity = 52/57 (91.23%), Postives = 54/57 (94.74%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|