MELO3C035312.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ACGAACTTCAAAACGTCTTTGAAAGTGGATGAAATGGATCGAGTCCTATCTATAGGAGATGGAATTGCATGAGTTTATGGATTGAAGGAGATTCAAGTTGGGGAAATGGTAGAATTTGTTAACGGTGTCAAACGAATAGCCTTAAATCTTGAGAATGAGAATGTAGGGATTGTTATATTTGGTAGTGATACTGCTATTAAAGAAGGAGATCTTGTCAAGCGCACTGGATCGATTATGGATATTCCAGCAAGAAAGGTTAAGGATGAG ACGAACTTCAAAACGTCTTTGAAAGTGGATGAAATGGATCGAGTCCTATCTATAGGAGATGGAATTGCATGAGTTTATGGATTGAAGGAGATTCAAGTTGGGGAAATGGTAGAATTTGTTAACGGTGTCAAACGAATAGCCTTAAATCTTGAGAATGAGAATGTAGGGATTGTTATATTTGGTAGTGATACTGCTATTAAAGAAGGAGATCTTGTCAAGCGCACTGGATCGATTATGGATATTCCAGCAAGAAAGGTTAAGGATGAG ATGGTAGAATTTGTTAACGGTGTCAAACGAATAGCCTTAAATCTTGAGAATGAGAATGTAGGGATTGTTATATTTGGTAGTGATACTGCTATTAAAGAAGGAGATCTTGTCAAGCGCACTGGATCGATTATGGATATTCCAGCAAGAAAGGTTAAGGATGAG MVEFVNGVKRIALNLENENVGIVIFGSDTAIKEGDLVKRTGSIMDIPARKVKDE
BLAST of MELO3C035312.2 vs. NCBI nr
Match: AAM12446.1 (ATP synthase alpha subunit, partial (mitochondrion) [Lissocarpa guianensis]) HSP 1 Score: 90.1 bits (222), Expect = 2.5e-15 Identity = 44/50 (88.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. NCBI nr
Match: AUD38671.1 (ATP synthase F1 subunit 1 (mitochondrion) [Colletoecema dewevrei]) HSP 1 Score: 90.1 bits (222), Expect = 2.5e-15 Identity = 44/50 (88.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. NCBI nr
Match: AAF17039.1 (ATPase alpha subunit, partial (mitochondrion) [Carludovica palmata]) HSP 1 Score: 89.7 bits (221), Expect = 3.2e-15 Identity = 44/50 (88.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. NCBI nr
Match: AAM12427.1 (ATP synthase alpha subunit, partial (mitochondrion) [Cornus suecica]) HSP 1 Score: 89.7 bits (221), Expect = 3.2e-15 Identity = 44/50 (88.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. NCBI nr
Match: AAQ74518.1 (F1-ATPase alpha subunit, partial (mitochondrion) [Cyclanthus bipartitus]) HSP 1 Score: 89.7 bits (221), Expect = 3.2e-15 Identity = 44/50 (88.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. TAIR10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein) HSP 1 Score: 84.3 bits (207), Expect = 2.4e-17 Identity = 41/50 (82.00%), Postives = 45/50 (90.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. TAIR10
Match: ATMG01190.1 (ATP synthase subunit 1) HSP 1 Score: 84.3 bits (207), Expect = 2.4e-17 Identity = 41/50 (82.00%), Postives = 45/50 (90.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. TAIR10
Match: ATCG00120.1 (ATP synthase subunit alpha) HSP 1 Score: 50.4 bits (119), Expect = 3.9e-07 Identity = 25/47 (53.19%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of MELO3C035312.2 vs. Swiss-Prot
Match: sp|Q06735|ATPAM_BETVU (ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris OX=161934 GN=ATPA PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 3.0e-17 Identity = 43/50 (86.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. Swiss-Prot
Match: sp|P18260|ATPAM_HELAN (ATP synthase subunit alpha, mitochondrial OS=Helianthus annuus OX=4232 GN=ATPA PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 3.0e-17 Identity = 43/50 (86.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. Swiss-Prot
Match: sp|P05494|ATPAM_MAIZE (ATP synthase subunit alpha, mitochondrial OS=Zea mays OX=4577 GN=ATPA PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 3.0e-17 Identity = 43/50 (86.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. Swiss-Prot
Match: sp|P05495|ATPAM_NICPL (ATP synthase subunit alpha, mitochondrial OS=Nicotiana plumbaginifolia OX=4092 GN=ATPA PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 3.0e-17 Identity = 43/50 (86.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. Swiss-Prot
Match: sp|P05492|ATPAM_OENBI (ATP synthase subunit alpha, mitochondrial OS=Oenothera biennis OX=3942 GN=ATPA PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 3.0e-17 Identity = 43/50 (86.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. TrEMBL
Match: tr|Q8SIE4|Q8SIE4_9ERIC (ATP synthase subunit alpha (Fragment) OS=Lissocarpa guianensis OX=185770 GN=atp1 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.6e-15 Identity = 44/50 (88.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. TrEMBL
Match: tr|A0A2H4WZE0|A0A2H4WZE0_9GENT (ATP synthase subunit alpha OS=Colletoecema dewevrei OX=110689 GN=atp1 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.6e-15 Identity = 44/50 (88.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. TrEMBL
Match: tr|S4W7Y4|S4W7Y4_9LILI (ATP synthase subunit alpha (Fragment) OS=Carludovica palmata OX=108411 GN=atpA PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 2.1e-15 Identity = 44/50 (88.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. TrEMBL
Match: tr|Q9T721|Q9T721_9LILI (ATP synthase subunit alpha (Fragment) OS=Carludovica palmata OX=108411 GN=atp1 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 2.1e-15 Identity = 44/50 (88.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MELO3C035312.2 vs. TrEMBL
Match: tr|S4WYK4|S4WYK4_9LILI (ATP synthase subunit alpha (Fragment) OS=Carludovica palmata OX=108411 GN=atpA PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 2.1e-15 Identity = 44/50 (88.00%), Postives = 47/50 (94.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |