MELO3C035263.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GGAAAGCACAGAAAATAAATCTACTAATTCAGGTTATAGATACGGTCAAGAAGAAGAAACTGAGAATATCGTAGCTGTTCATGGTTATTTTGGTCGATTGCTCTTCTATGCTAGTTTCAACAACTCTCGTTCTTTACATTTCTTCCTAGCTACTTGGCCTGTAGTAGGTATCTGGTTCACCGTTTTAGGTATTAGCACTATGGCTTTCAAAAAATGGTTTTAATTTCAACCAATCTATAATTGATAGTTAAGGTCGTGTAATTCATACCTGGGCTGAGATTCTTAATCATGCTAATCTTGGTATGGAAGTAATGCATGAACGTAATGCTCACAACTTCCCTCTAGATCTAGCTGCTGTTGAAGTTCCATCTATCAATGAATAA GGAAAGCACAGAAAATAAATCTACTAATTCAGGTTATAGATACGGTCAAGAAGAAGAAACTGAGAATATCGTAGCTGTTCATGGTTATTTTGGTCGATTGCTCTTCTATGCTAGTTTCAACAACTCTCGTTCTTTACATTTCTTCCTAGCTACTTGGCCTGTAGTAGGTATCTGGTTCACCGTTTTAGGTATTAGCACTATGGCTTTCAAAAAATGGTTTTAATTTCAACCAATCTATAATTGATAGTTAAGGTCGTGTAATTCATACCTGGGCTGAGATTCTTAATCATGCTAATCTTGGTATGGAAGTAATGCATGAACGTAATGCTCACAACTTCCCTCTAGATCTAGCTGCTGTTGAAGTTCCATCTATCAATGAATAA GAAAGCACAGAAAATAAATCTACTAATTCAGGTTATAGATACGGTCAAGAAGAAGAAACTGAGAATATCGTAGCTGTTCATGGTTATTTTGGTCGATTGCTCTTCTATGCTAGTTTCAACAACTCTCGTTCTTTACATTTCTTCCTAGCTACTTGGCCTGTAGTAGGTATCTGGTTCACCGTTTTAGGTATTAGCACTATGGCTTTCAAAAAATGGTTTTAA ESTENKSTNSGYRYGQEEETENIVAVHGYFGRLLFYASFNNSRSLHFFLATWPVVGIWFTVLGISTMAFKKWF
BLAST of MELO3C035263.2 vs. NCBI nr
Match: YP_009367426.1 (D1 reaction center protein of photosystem II (chloroplast) [Sarcinofilum mucosum] >ARK14401.1 D1 reaction center protein of photosystem II (chloroplast) [Sarcinofilum mucosum]) HSP 1 Score: 122.5 bits (306), Expect = 6.0e-25 Identity = 60/70 (85.71%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of MELO3C035263.2 vs. NCBI nr
Match: AWX53406.1 (PsbA (chloroplast) [Ulothrix zonata]) HSP 1 Score: 122.5 bits (306), Expect = 6.0e-25 Identity = 60/70 (85.71%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of MELO3C035263.2 vs. NCBI nr
Match: YP_009175254.1 (photosystem II reaction center protein D1 (chloroplast) [Phragmipedium longifolium] >AIS67513.1 photosystem II reaction center protein D1 (chloroplast) [Phragmipedium longifolium]) HSP 1 Score: 122.1 bits (305), Expect = 7.9e-25 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C035263.2 vs. NCBI nr
Match: PHT54975.1 (Photosystem II protein D1 [Capsicum baccatum]) HSP 1 Score: 122.1 bits (305), Expect = 7.9e-25 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C035263.2 vs. NCBI nr
Match: BAA96363.1 (photosystem II Qb protein, partial [Bruguiera gymnorhiza]) HSP 1 Score: 121.7 bits (304), Expect = 1.0e-24 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C035263.2 vs. TAIR10
Match: ATCG00020.1 (photosystem II reaction center protein A) HSP 1 Score: 120.2 bits (300), Expect = 5.4e-28 Identity = 59/70 (84.29%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of MELO3C035263.2 vs. Swiss-Prot
Match: sp|Q3ZJ60|PSBA_TUPAK (Photosystem II protein D1 OS=Tupiella akineta OX=160070 GN=psbA PE=3 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 4.4e-27 Identity = 59/70 (84.29%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of MELO3C035263.2 vs. Swiss-Prot
Match: sp|Q70Y17|PSBA_AMBTC (Photosystem II protein D1 OS=Amborella trichopoda OX=13333 GN=psbA PE=3 SV=2) HSP 1 Score: 120.6 bits (301), Expect = 7.5e-27 Identity = 59/70 (84.29%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C035263.2 vs. Swiss-Prot
Match: sp|Q7YJY8|PSBA_CALFG (Photosystem II protein D1 OS=Calycanthus floridus var. glaucus OX=212734 GN=psbA PE=3 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 7.5e-27 Identity = 59/70 (84.29%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C035263.2 vs. Swiss-Prot
Match: sp|A6MMA2|PSBA_CHLSC (Photosystem II protein D1 OS=Chloranthus spicatus OX=13006 GN=psbA PE=3 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 7.5e-27 Identity = 59/70 (84.29%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C035263.2 vs. Swiss-Prot
Match: sp|Q09MJ8|PSBA_CITSI (Photosystem II protein D1 OS=Citrus sinensis OX=2711 GN=psbA PE=3 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 7.5e-27 Identity = 59/70 (84.29%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C035263.2 vs. TrEMBL
Match: tr|A0A1W6EG83|A0A1W6EG83_SARMC (Photosystem II protein D1 OS=Sarcinofilum mucosum OX=141643 GN=psbA PE=3 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 4.0e-25 Identity = 60/70 (85.71%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of MELO3C035263.2 vs. TrEMBL
Match: tr|A0A2G2XBW8|A0A2G2XBW8_CAPBA (Photosystem II protein D1 OS=Capsicum baccatum OX=33114 GN=CQW23_03461 PE=3 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 5.2e-25 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C035263.2 vs. TrEMBL
Match: tr|A0A0N6Z0A2|A0A0N6Z0A2_9ASPA (Photosystem II protein D1 OS=Phragmipedium longifolium OX=53134 GN=psbA PE=3 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 5.2e-25 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C035263.2 vs. TrEMBL
Match: tr|Q9MAW0|Q9MAW0_BRUGY (Photosystem II Qb protein (Fragment) OS=Bruguiera gymnorhiza OX=39984 GN=psbA PE=2 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 6.8e-25 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C035263.2 vs. TrEMBL
Match: tr|A0A1B2RZ47|A0A1B2RZ47_9CHLO (Photosystem II protein D1 OS=Gloeotilopsis planctonica OX=34157 GN=psbA PE=3 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 8.9e-25 Identity = 59/70 (84.29%), Postives = 65/70 (92.86%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |