MELO3C034930.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.GGAATTTGTCGACGACAGACAGGCAATTGATGACACTTTGTTCGGAGTTTTTGAGCAGCGAGACAGACATGACGGAGACAATGATAGAGTGGGGGATGGCGGAATTGATAGCGAATGAGGAAGTTCTGACGAATATTGTGGAAGAAATTAAAGAGACAGTTGGTGAGAGAAAAGTAGAGGTATATATTAAATAA GGAATTTGTCGACGACAGACAGGCAATTGATGACACTTTGTTCGGAGTTTTTGAGCAGCGAGACAGACATGACGGAGACAATGATAGAGTGGGGGATGGCGGAATTGATAGCGAATGAGGAAGTTCTGACGAATATTGTGGAAGAAATTAAAGAGACAGTTGGTGAGAGAAAAGTAGAGGTATATATTAAATAA ATGACACTTTGTTCGGAGTTTTTGAGCAGCGAGACAGACATGACGGAGACAATGATAGAGTGGGGGATGGCGGAATTGATAGCGAATGAGGAAGTTCTGACGAATATTGTGGAAGAAATTAAAGAGACAGTTGGTGAGAGAAAAGTAGAGGTATATATTAAATAA MTLCSEFLSSETDMTETMIEWGMAELIANEEVLTNIVEEIKETVGERKVEVYIK
BLAST of MELO3C034930.2 vs. NCBI nr
Match: XP_011655840.1 (PREDICTED: cytochrome P450 77A3-like [Cucumis sativus] >KGN52206.1 hypothetical protein Csa_5G615280 [Cucumis sativus]) HSP 1 Score: 75.5 bits (184), Expect = 6.3e-11 Identity = 39/50 (78.00%), Postives = 43/50 (86.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. NCBI nr
Match: XP_008446777.2 (PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Cucumis melo]) HSP 1 Score: 75.5 bits (184), Expect = 6.3e-11 Identity = 39/50 (78.00%), Postives = 43/50 (86.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. NCBI nr
Match: KOM35652.1 (hypothetical protein LR48_Vigan02g180200 [Vigna angularis]) HSP 1 Score: 63.5 bits (153), Expect = 2.5e-07 Identity = 31/50 (62.00%), Postives = 40/50 (80.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. NCBI nr
Match: XP_017413301.1 (PREDICTED: cytochrome P450 77A3 [Vigna angularis] >BAT94555.1 hypothetical protein VIGAN_08116800 [Vigna angularis var. angularis]) HSP 1 Score: 63.5 bits (153), Expect = 2.5e-07 Identity = 31/50 (62.00%), Postives = 40/50 (80.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. NCBI nr
Match: XP_007143825.1 (hypothetical protein PHAVU_007G104800g [Phaseolus vulgaris] >ESW15819.1 hypothetical protein PHAVU_007G104800g [Phaseolus vulgaris]) HSP 1 Score: 63.2 bits (152), Expect = 3.2e-07 Identity = 31/50 (62.00%), Postives = 39/50 (78.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. TAIR10
Match: AT3G10560.1 (Cytochrome P450 superfamily protein) HSP 1 Score: 59.3 bits (142), Expect = 8.4e-10 Identity = 29/50 (58.00%), Postives = 39/50 (78.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. TAIR10
Match: AT3G10570.1 (cytochrome P450, family 77, subfamily A, polypeptide 6) HSP 1 Score: 58.5 bits (140), Expect = 1.4e-09 Identity = 28/50 (56.00%), Postives = 39/50 (78.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. TAIR10
Match: AT5G04660.1 (cytochrome P450, family 77, subfamily A, polypeptide 4) HSP 1 Score: 56.2 bits (134), Expect = 7.1e-09 Identity = 29/51 (56.86%), Postives = 40/51 (78.43%), Query Frame = 0
BLAST of MELO3C034930.2 vs. TAIR10
Match: AT5G04630.1 (cytochrome P450, family 77, subfamily A, polypeptide 9) HSP 1 Score: 55.1 bits (131), Expect = 1.6e-08 Identity = 29/51 (56.86%), Postives = 40/51 (78.43%), Query Frame = 0
BLAST of MELO3C034930.2 vs. TAIR10
Match: AT1G64940.1 (cytochrome P450, family 87, subfamily A, polypeptide 6) HSP 1 Score: 48.9 bits (115), Expect = 1.1e-06 Identity = 25/51 (49.02%), Postives = 34/51 (66.67%), Query Frame = 0
BLAST of MELO3C034930.2 vs. Swiss-Prot
Match: sp|O48928|C77A3_SOYBN (Cytochrome P450 77A3 OS=Glycine max OX=3847 GN=CYP77A3 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 3.1e-09 Identity = 30/50 (60.00%), Postives = 39/50 (78.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. Swiss-Prot
Match: sp|Q9LZ31|C77A4_ARATH (Cytochrome P450 77A4 OS=Arabidopsis thaliana OX=3702 GN=CYP77A4 PE=2 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.3e-07 Identity = 29/51 (56.86%), Postives = 40/51 (78.43%), Query Frame = 0
BLAST of MELO3C034930.2 vs. Swiss-Prot
Match: sp|P37124|C77A2_SOLME (Cytochrome P450 77A2 OS=Solanum melongena OX=4111 GN=CYP77A2 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 4.9e-07 Identity = 26/50 (52.00%), Postives = 35/50 (70.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. Swiss-Prot
Match: sp|P37123|C77A1_SOLME (Cytochrome P450 77A1 (Fragment) OS=Solanum melongena OX=4111 GN=CYP77A1 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.2e-05 Identity = 23/50 (46.00%), Postives = 34/50 (68.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. Swiss-Prot
Match: sp|Q42602|C89A2_ARATH (Cytochrome P450 89A2 OS=Arabidopsis thaliana OX=3702 GN=CYP89A2 PE=2 SV=2) HSP 1 Score: 46.6 bits (109), Expect = 1.0e-04 Identity = 25/51 (49.02%), Postives = 32/51 (62.75%), Query Frame = 0
BLAST of MELO3C034930.2 vs. TrEMBL
Match: tr|A0A1S3BGP7|A0A1S3BGP7_CUCME (LOW QUALITY PROTEIN: cytochrome P450 77A3-like OS=Cucumis melo OX=3656 GN=LOC103489405 PE=3 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 4.1e-11 Identity = 39/50 (78.00%), Postives = 43/50 (86.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. TrEMBL
Match: tr|A0A0A0KWN5|A0A0A0KWN5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G615280 PE=3 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 4.1e-11 Identity = 39/50 (78.00%), Postives = 43/50 (86.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. TrEMBL
Match: tr|A0A0L9TZ26|A0A0L9TZ26_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan02g180200 PE=3 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-07 Identity = 31/50 (62.00%), Postives = 40/50 (80.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. TrEMBL
Match: tr|A0A0S3SP59|A0A0S3SP59_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis OX=157739 GN=Vigan.08G116800 PE=3 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-07 Identity = 31/50 (62.00%), Postives = 40/50 (80.00%), Query Frame = 0
BLAST of MELO3C034930.2 vs. TrEMBL
Match: tr|V7BDC4|V7BDC4_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris OX=3885 GN=PHAVU_007G104800g PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.1e-07 Identity = 31/50 (62.00%), Postives = 39/50 (78.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |