MELO3C034797.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTTCTGAGTAGCCTGGCTGGGATTCAAGAGGGAAAGGATGCGATTATGGAAGAGGGTGGAATTGTTGCGCTTCTAGAAGCAATTGAAGATGGGTCGGTGAAATGGAAAGAATTTGCAGTGTTGACACTCTTGCAATTGTGTGTTGAGAGTGTGAGAAATCGAGGGTTACTCGTCAGGTGGAATTCCCCCTTTAGTTGCACTTTCTCATACTGGAAGCGTTCGAGCAAAGCATAAG ATGCTTCTGAGTAGCCTGGCTGGGATTCAAGAGGGAAAGGATGCGATTATGGAAGAGGGTGGAATTGTTGCGCTTCTAGAAGCAATTGAAGATGGGTCGGTGAAATGGAAAGAATTTGCAGTGTTGACACTCTTGCAATTGTGTGTTGAGAGTGTGAGAAATCGAGGGTTACTCGTCAGGTGGAATTCCCCCTTTAGTTGCACTTTCTCATACTGGAAGCGTTCGAGCAAAGCATAAG ATGCTTCTGAGTAGCCTGGCTGGGATTCAAGAGGGAAAGGATGCGATTATGGAAGAGGGTGGAATTGTTGCGCTTCTAGAAGCAATTGAAGATGGGTCGGTGAAATGGAAAGAATTTGCAGTGTTGACACTCTTGCAATTGTGTGTTGAGAGTGTGAGAAATCGAGGGTTACTCGTCAGGTGGAATTCCCCCTTTAGTTGCACTTTCTCATACTGGAAGCGTTCGAGCAAAGCATAA MLLSSLAGIQEGKDAIMEEGGIVALLEAIEDGSVKWKEFAVLTLLQLCVESVRNRGLLVRWNSPFSCTFSYWKRSSKA
BLAST of MELO3C034797.2 vs. NCBI nr
Match: XP_008467070.1 (PREDICTED: U-box domain-containing protein 3-like [Cucumis melo]) HSP 1 Score: 97.4 bits (241), Expect = 2.2e-17 Identity = 52/59 (88.14%), Postives = 55/59 (93.22%), Query Frame = 0
BLAST of MELO3C034797.2 vs. NCBI nr
Match: POE71741.1 (u-box domain-containing protein 2 [Quercus suber]) HSP 1 Score: 94.0 bits (232), Expect = 2.5e-16 Identity = 46/60 (76.67%), Postives = 56/60 (93.33%), Query Frame = 0
BLAST of MELO3C034797.2 vs. NCBI nr
Match: KHN40819.1 (U-box domain-containing protein 2 [Glycine soja]) HSP 1 Score: 91.7 bits (226), Expect = 1.2e-15 Identity = 47/56 (83.93%), Postives = 53/56 (94.64%), Query Frame = 0
BLAST of MELO3C034797.2 vs. NCBI nr
Match: KHN42282.1 (U-box domain-containing protein 2 [Glycine soja]) HSP 1 Score: 90.5 bits (223), Expect = 2.7e-15 Identity = 47/60 (78.33%), Postives = 54/60 (90.00%), Query Frame = 0
BLAST of MELO3C034797.2 vs. NCBI nr
Match: XP_010539196.1 (PREDICTED: U-box domain-containing protein 4-like [Tarenaya hassleriana]) HSP 1 Score: 89.4 bits (220), Expect = 6.0e-15 Identity = 45/60 (75.00%), Postives = 54/60 (90.00%), Query Frame = 0
BLAST of MELO3C034797.2 vs. TAIR10
Match: AT5G67340.1 (ARM repeat superfamily protein) HSP 1 Score: 51.2 bits (121), Expect = 3.3e-07 Identity = 27/51 (52.94%), Postives = 36/51 (70.59%), Query Frame = 0
BLAST of MELO3C034797.2 vs. TAIR10
Match: AT3G54790.1 (ARM repeat superfamily protein) HSP 1 Score: 47.8 bits (112), Expect = 3.7e-06 Identity = 24/50 (48.00%), Postives = 35/50 (70.00%), Query Frame = 0
BLAST of MELO3C034797.2 vs. Swiss-Prot
Match: sp|Q5XEZ8|PUB2_ARATH (U-box domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=PUB2 PE=2 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 6.0e-06 Identity = 27/51 (52.94%), Postives = 36/51 (70.59%), Query Frame = 0
BLAST of MELO3C034797.2 vs. Swiss-Prot
Match: sp|Q8GWV5|PUB3_ARATH (U-box domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=PUB3 PE=2 SV=2) HSP 1 Score: 47.8 bits (112), Expect = 6.6e-05 Identity = 24/50 (48.00%), Postives = 35/50 (70.00%), Query Frame = 0
BLAST of MELO3C034797.2 vs. TrEMBL
Match: tr|A0A1S3CTY9|A0A1S3CTY9_CUCME (U-box domain-containing protein 3-like OS=Cucumis melo OX=3656 GN=LOC103504507 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 1.5e-17 Identity = 52/59 (88.14%), Postives = 55/59 (93.22%), Query Frame = 0
BLAST of MELO3C034797.2 vs. TrEMBL
Match: tr|A0A2P4IT93|A0A2P4IT93_QUESU (U-box domain-containing protein 2 OS=Quercus suber OX=58331 GN=CFP56_31844 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.6e-16 Identity = 46/60 (76.67%), Postives = 56/60 (93.33%), Query Frame = 0
BLAST of MELO3C034797.2 vs. TrEMBL
Match: tr|A0A0B2SDD9|A0A0B2SDD9_GLYSO (U-box domain-containing protein 2 OS=Glycine soja OX=3848 GN=glysoja_042030 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.8e-15 Identity = 47/60 (78.33%), Postives = 54/60 (90.00%), Query Frame = 0
BLAST of MELO3C034797.2 vs. TrEMBL
Match: tr|A0A1S3CFT8|A0A1S3CFT8_CUCME (tetraspanin-8-like OS=Cucumis melo OX=3656 GN=LOC103500450 PE=4 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 1.2e-14 Identity = 45/49 (91.84%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of MELO3C034797.2 vs. TrEMBL
Match: tr|A0A2I4F9U2|A0A2I4F9U2_9ROSI (U-box domain-containing protein 2-like OS=Juglans regia OX=51240 GN=LOC108996845 PE=4 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 4.4e-14 Identity = 42/56 (75.00%), Postives = 51/56 (91.07%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |