MELO3C034667.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAAGGAACATGCGCAAGGCAGTCGCATACAAGGGAAGAGGTAGAGACATACGAAGAAGATGAAGACGAGCACGGTGACACCTTATGTAGGGCATGCGGTGAGAACTATGCTTCAGATGAATTTTGGATTTGCTGTGATATCTATGAGAAATGGTTCCATGGGAAGTTTGTTGTATGA ATGCAAGGAACATGCGCAAGGCAGTCGCATACAAGGGAAGAGGTAGAGACATACGAAGAAGATGAAGACGAGCACGGTGACACCTTATGTAGGGCATGCGGTGAGAACTATGCTTCAGATGAATTTTGGATTTGCTGTGATATCTATGAGAAATGGTTCCATGGGAAGTTTGTTGTATGA ATGCAAGGAACATGCGCAAGGCAGTCGCATACAAGGGAAGAGGTAGAGACATACGAAGAAGATGAAGACGAGCACGGTGACACCTTATGTAGGGCATGCGGTGAGAACTATGCTTCAGATGAATTTTGGATTTGCTGTGATATCTATGAGAAATGGTTCCATGGGAAGTTTGTTGTATGA MQGTCARQSHTREEVETYEEDEDEHGDTLCRACGENYASDEFWICCDIYEKWFHGKFVV
BLAST of MELO3C034667.2 vs. NCBI nr
Match: XP_016903323.1 (PREDICTED: PHD finger protein ALFIN-LIKE 3-like [Cucumis melo]) HSP 1 Score: 121.7 bits (304), Expect = 8.3e-25 Identity = 53/59 (89.83%), Postives = 55/59 (93.22%), Query Frame = 0
BLAST of MELO3C034667.2 vs. NCBI nr
Match: XP_004141692.1 (PREDICTED: PHD finger protein ALFIN-LIKE 3-like isoform X1 [Cucumis sativus] >KGN45504.1 hypothetical protein Csa_7G450620 [Cucumis sativus]) HSP 1 Score: 107.1 bits (266), Expect = 2.1e-20 Identity = 51/59 (86.44%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of MELO3C034667.2 vs. NCBI nr
Match: XP_008462330.1 (PREDICTED: PHD finger protein ALFIN-LIKE 3-like isoform X1 [Cucumis melo]) HSP 1 Score: 105.1 bits (261), Expect = 8.1e-20 Identity = 50/58 (86.21%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MELO3C034667.2 vs. NCBI nr
Match: XP_008462331.1 (PREDICTED: PHD finger protein ALFIN-LIKE 3-like isoform X2 [Cucumis melo]) HSP 1 Score: 105.1 bits (261), Expect = 8.1e-20 Identity = 50/58 (86.21%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MELO3C034667.2 vs. NCBI nr
Match: XP_022992372.1 (PHD finger protein ALFIN-LIKE 3-like [Cucurbita maxima]) HSP 1 Score: 101.7 bits (252), Expect = 8.9e-19 Identity = 48/59 (81.36%), Postives = 49/59 (83.05%), Query Frame = 0
BLAST of MELO3C034667.2 vs. TAIR10
Match: AT5G05610.1 (alfin-like 1) HSP 1 Score: 78.6 bits (192), Expect = 1.5e-15 Identity = 29/43 (67.44%), Postives = 38/43 (88.37%), Query Frame = 0
BLAST of MELO3C034667.2 vs. TAIR10
Match: AT5G20510.1 (alfin-like 5) HSP 1 Score: 68.2 bits (165), Expect = 2.0e-12 Identity = 26/33 (78.79%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MELO3C034667.2 vs. TAIR10
Match: AT3G11200.1 (alfin-like 2) HSP 1 Score: 60.8 bits (146), Expect = 3.2e-10 Identity = 21/33 (63.64%), Postives = 28/33 (84.85%), Query Frame = 0
BLAST of MELO3C034667.2 vs. TAIR10
Match: AT5G26210.1 (alfin-like 4) HSP 1 Score: 60.5 bits (145), Expect = 4.1e-10 Identity = 23/31 (74.19%), Postives = 26/31 (83.87%), Query Frame = 0
BLAST of MELO3C034667.2 vs. TAIR10
Match: AT2G02470.1 (alfin-like 6) HSP 1 Score: 60.1 bits (144), Expect = 5.4e-10 Identity = 22/30 (73.33%), Postives = 25/30 (83.33%), Query Frame = 0
BLAST of MELO3C034667.2 vs. Swiss-Prot
Match: sp|Q9FFF5|ALFL1_ARATH (PHD finger protein ALFIN-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=AL1 PE=1 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 2.6e-14 Identity = 29/43 (67.44%), Postives = 38/43 (88.37%), Query Frame = 0
BLAST of MELO3C034667.2 vs. Swiss-Prot
Match: sp|Q5XEM9|ALFL5_ARATH (PHD finger protein ALFIN-LIKE 5 OS=Arabidopsis thaliana OX=3702 GN=AL5 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 3.6e-11 Identity = 26/33 (78.79%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MELO3C034667.2 vs. Swiss-Prot
Match: sp|B8B8C5|ALFL9_ORYSI (PHD finger protein ALFIN-LIKE 9 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_26819 PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 6.1e-11 Identity = 26/33 (78.79%), Postives = 29/33 (87.88%), Query Frame = 0
BLAST of MELO3C034667.2 vs. Swiss-Prot
Match: sp|Q6YTY3|ALFL9_ORYSJ (PHD finger protein ALFIN-LIKE 9 OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0608400 PE=2 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 6.1e-11 Identity = 26/33 (78.79%), Postives = 29/33 (87.88%), Query Frame = 0
BLAST of MELO3C034667.2 vs. Swiss-Prot
Match: sp|A2Y0Q2|ALFL1_ORYSI (PHD finger protein ALFIN-LIKE 1 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_18576 PE=3 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.0e-10 Identity = 26/51 (50.98%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of MELO3C034667.2 vs. TrEMBL
Match: tr|A0A1S4E514|A0A1S4E514_CUCME (PHD finger protein ALFIN-LIKE 3-like OS=Cucumis melo OX=3656 GN=LOC107992128 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 5.5e-25 Identity = 53/59 (89.83%), Postives = 55/59 (93.22%), Query Frame = 0
BLAST of MELO3C034667.2 vs. TrEMBL
Match: tr|A0A0A0K9L1|A0A0A0K9L1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G450620 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.4e-20 Identity = 51/59 (86.44%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of MELO3C034667.2 vs. TrEMBL
Match: tr|A0A1S3CI87|A0A1S3CI87_CUCME (PHD finger protein ALFIN-LIKE 3-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103500707 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 5.3e-20 Identity = 50/58 (86.21%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MELO3C034667.2 vs. TrEMBL
Match: tr|A0A1S3CGR0|A0A1S3CGR0_CUCME (PHD finger protein ALFIN-LIKE 3-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103500707 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 5.3e-20 Identity = 50/58 (86.21%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MELO3C034667.2 vs. TrEMBL
Match: tr|A0A2P6Q1H7|A0A2P6Q1H7_ROSCH (Putative chromatin regulator PHD family OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr6g0311511 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 3.0e-15 Identity = 41/59 (69.49%), Postives = 46/59 (77.97%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|