MELO3C034654.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATATATCTTCTAATCTCACCAAGCTAGGAAGAACCCTTGTAGCTGTCATCTCAGCTGGTGTAAAATCGATATTAGACATCCCTAGGACCCTTGAATATTTAGTACAGTCTTCTATTTTCCTGCAATAAACCTTTTTACACATCATGCAGCTTTCTTTTTTATTTATTCACTGGCTCAAAAATGTTATTAACACAGGAAACTCAGGGAGTATGTGTTGCAGCTTATAGAACGACGGACGAATTTTTTGCTTTTTTCATGGAAACCAGTGGCTGCAAG ATGGATATATCTTCTAATCTCACCAAGCTAGGAAGAACCCTTGTAGCTGTCATCTCAGCTGGTGTAAAATCGATATTAGACATCCCTAGGACCCTTGAATATTTAGAAACTCAGGGAGTATGTGTTGCAGCTTATAGAACGACGGACGAATTTTTTGCTTTTTTCATGGAAACCAGTGGCTGCAAG ATGGATATATCTTCTAATCTCACCAAGCTAGGAAGAACCCTTGTAGCTGTCATCTCAGCTGGTGTAAAATCGATATTAGACATCCCTAGGACCCTTGAATATTTAGAAACTCAGGGAGTATGTGTTGCAGCTTATAGAACGACGGACGAATTTTTTGCTTTTTTCATGGAAACCAGTGGCTGCAAG MDISSNLTKLGRTLVAVISAGVKSILDIPRTLEYLETQGVCVAAYRTTDEFFAFFMETSGCK
BLAST of MELO3C034654.2 vs. NCBI nr
Match: XP_022988167.1 (uncharacterized protein LOC111485484 [Cucurbita maxima]) HSP 1 Score: 105.1 bits (261), Expect = 8.5e-20 Identity = 56/62 (90.32%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C034654.2 vs. NCBI nr
Match: XP_023515450.1 (uncharacterized protein LOC111779605 [Cucurbita pepo subsp. pepo] >XP_023515451.1 uncharacterized protein LOC111779605 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 105.1 bits (261), Expect = 8.5e-20 Identity = 56/62 (90.32%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C034654.2 vs. NCBI nr
Match: XP_012065478.1 (uncharacterized protein LOC105628643 [Jatropha curcas] >KDP43637.1 hypothetical protein JCGZ_22951 [Jatropha curcas]) HSP 1 Score: 104.0 bits (258), Expect = 1.9e-19 Identity = 55/62 (88.71%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C034654.2 vs. NCBI nr
Match: XP_023924233.1 (uncharacterized protein LOC112035633 isoform X1 [Quercus suber] >POE95963.1 pseudouridine-5'-phosphate glycosidase [Quercus suber]) HSP 1 Score: 103.6 bits (257), Expect = 2.5e-19 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C034654.2 vs. NCBI nr
Match: POE95962.1 (pseudouridine-5'-phosphate glycosidase [Quercus suber]) HSP 1 Score: 103.6 bits (257), Expect = 2.5e-19 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C034654.2 vs. TAIR10
Match: AT1G50510.1 (indigoidine synthase A family protein) HSP 1 Score: 90.5 bits (223), Expect = 3.9e-19 Identity = 49/62 (79.03%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of MELO3C034654.2 vs. Swiss-Prot
Match: sp|C0ZIY1|PSUG_BREBN (Pseudouridine-5'-phosphate glycosidase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) OX=358681 GN=psuG PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 3.4e-12 Identity = 39/59 (66.10%), Postives = 46/59 (77.97%), Query Frame = 0
BLAST of MELO3C034654.2 vs. Swiss-Prot
Match: sp|Q1M4T3|PSUG2_RHIL3 (Pseudouridine-5'-phosphate glycosidase 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=psuG2 PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 4.4e-12 Identity = 41/61 (67.21%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of MELO3C034654.2 vs. Swiss-Prot
Match: sp|B8II14|PSUG_METNO (Pseudouridine-5'-phosphate glycosidase OS=Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060) OX=460265 GN=psuG PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.3e-11 Identity = 37/60 (61.67%), Postives = 46/60 (76.67%), Query Frame = 0
BLAST of MELO3C034654.2 vs. Swiss-Prot
Match: sp|B9LGZ1|PSUG_CHLSY (Pseudouridine-5'-phosphate glycosidase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) OX=480224 GN=psuG PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 2.9e-11 Identity = 36/59 (61.02%), Postives = 45/59 (76.27%), Query Frame = 0
BLAST of MELO3C034654.2 vs. Swiss-Prot
Match: sp|Q8NYD0|PSUG_STAAW (Pseudouridine-5'-phosphate glycosidase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=psuG PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 8.4e-11 Identity = 36/62 (58.06%), Postives = 46/62 (74.19%), Query Frame = 0
BLAST of MELO3C034654.2 vs. TrEMBL
Match: tr|A0A067L5E0|A0A067L5E0_JATCU (Uncharacterized protein OS=Jatropha curcas OX=180498 GN=JCGZ_22951 PE=3 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 1.2e-19 Identity = 55/62 (88.71%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C034654.2 vs. TrEMBL
Match: tr|A0A2P4KSM2|A0A2P4KSM2_QUESU (Pseudouridine-5'-phosphate glycosidase OS=Quercus suber OX=58331 GN=CFP56_47056 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.6e-19 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C034654.2 vs. TrEMBL
Match: tr|A0A2P4KSF2|A0A2P4KSF2_QUESU (Pseudouridine-5'-phosphate glycosidase OS=Quercus suber OX=58331 GN=CFP56_47056 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.6e-19 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C034654.2 vs. TrEMBL
Match: tr|A0A0A0LXQ4|A0A0A0LXQ4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G616850 PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.1e-19 Identity = 55/62 (88.71%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of MELO3C034654.2 vs. TrEMBL
Match: tr|M5X1Q1|M5X1Q1_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_ppa009681mg PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.8e-19 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|