MELO3C034269.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGCAAATGAAGAAAGTATTAAGAACAAAGAGAAAGTGAAGAGCTTACTTCTTCTACTGCAGGCAACATATGAAGAAAGAGATGAAGTAAGAGATCAACTGCACAAACTGATGAACAAGATTATGCCAACTTCAATTAACTTCATTGGCCATCATGTTAATCAATCTCAACTTCAATTTTTTTCTTCACAGCAGAAAATATGACAAGAA ATGGAAGCAAATGAAGAAAGTATTAAGAACAAAGAGAAAGTGAAGAGCTTACTTCTTCTACTGCAGGCAACATATGAAGAAAGAGATGAAGTAAGAGATCAACTGCACAAACTGATGAACAAGATTATGCCAACTTCAATTAACTTCATTGGCCATCATGTTAATCAATCTCAACTTCAATTTTTTTCTTCACAGCAGAAAATATGACAAGAA ATGGAAGCAAATGAAGAAAGTATTAAGAACAAAGAGAAAGTGAAGAGCTTACTTCTTCTACTGCAGGCAACATATGAAGAAAGAGATGAAGTAAGAGATCAACTGCACAAACTGATGAACAAGATTATGCCAACTTCAATTAACTTCATTGGCCATCATGTTAATCAATCTCAACTTCAATTTTTTTCTTCACAGCAGAAAATATGA MEANEESIKNKEKVKSLLLLLQATYEERDEVRDQLHKLMNKIMPTSINFIGHHVNQSQLQFFSSQQKI
BLAST of MELO3C034269.2 vs. NCBI nr
Match: XP_011657251.1 (PREDICTED: uncharacterized protein LOC101217302 [Cucumis sativus] >KGN47356.1 hypothetical protein Csa_6G303220 [Cucumis sativus]) HSP 1 Score: 80.9 bits (198), Expect = 1.9e-12 Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MELO3C034269.2 vs. NCBI nr
Match: XP_022148299.1 (uncharacterized protein LOC111016987 [Momordica charantia]) HSP 1 Score: 79.7 bits (195), Expect = 4.2e-12 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C034269.2 vs. NCBI nr
Match: XP_022943940.1 (uncharacterized protein LOC111448511 [Cucurbita moschata]) HSP 1 Score: 79.7 bits (195), Expect = 4.2e-12 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C034269.2 vs. NCBI nr
Match: XP_022986908.1 (uncharacterized protein LOC111484506 [Cucurbita maxima]) HSP 1 Score: 79.7 bits (195), Expect = 4.2e-12 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C034269.2 vs. NCBI nr
Match: XP_023511993.1 (uncharacterized protein LOC111776837 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 79.7 bits (195), Expect = 4.2e-12 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C034269.2 vs. TAIR10
Match: AT2G28690.1 (Protein of unknown function (DUF1635)) HSP 1 Score: 40.8 bits (94), Expect = 3.9e-04 Identity = 25/61 (40.98%), Postives = 37/61 (60.66%), Query Frame = 0
BLAST of MELO3C034269.2 vs. TrEMBL
Match: tr|A0A0A0KHV7|A0A0A0KHV7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G303220 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.2e-12 Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MELO3C034269.2 vs. TrEMBL
Match: tr|A0A1S3BKE0|A0A1S3BKE0_CUCME (Uncharacterized protein OS=Cucumis melo OX=3656 GN=LOC103490578 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 3.6e-12 Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MELO3C034269.2 vs. TrEMBL
Match: tr|A0A2I4EMN7|A0A2I4EMN7_9ROSI (uncharacterized protein LOC108990971 isoform X1 OS=Juglans regia OX=51240 GN=LOC108990971 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.7e-06 Identity = 32/46 (69.57%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of MELO3C034269.2 vs. TrEMBL
Match: tr|A0A2I4EMN8|A0A2I4EMN8_9ROSI (uncharacterized protein LOC108990971 isoform X2 OS=Juglans regia OX=51240 GN=LOC108990971 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.7e-06 Identity = 32/46 (69.57%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of MELO3C034269.2 vs. TrEMBL
Match: tr|A0A1R3J982|A0A1R3J982_9ROSI (Uncharacterized protein OS=Corchorus olitorius OX=93759 GN=COLO4_18442 PE=4 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 5.6e-05 Identity = 31/71 (43.66%), Postives = 47/71 (66.20%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|