MELO3C034228.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GCAAGAAAGCTCTATAAAAAAAATGGTTAAATTCGATGTTGTCAAGGGAAGGCCAAGTAAATCAATCAATAGTCTTGGTCCTATTGAAAGTGAAGAATCAATTATATATAATATGAATAATAACATTCCTAGCCATAGAGATAGTTACAAATCTAGTTGTCGTACTGTTGATGATTTAGTCGGCATTTGGAATTTCATATATGATGACACTTTTTTAGTTAGGGATAGTAATAGCAGCAGTTATTCCATCTATTTGGATATTGAAAATCAAATTTTTAAGATTGACAATGATCCTTCTTTTGTAAGTGAACTAGAAAATTCTTTTTATAGTTTTCGAAACTCTACTTATCAAAATAATGTATCTAAGAGTGATGATTCTCACTATGATCAGTATATGTACGATACTAAATATAGTTGGAATAATCACATTAATAGTTGCATTAACAATTATCTTTAGACTCAAATCTGTATTGATAGTTACATTTTAAGTGATAGTCACAATTACAGTGATAGTTACATTTATAGTTCTATTTGTGCTTAAGGTGGAAATAGTAGTCAAA GCAAGAAAGCTCTATAAAAAAAATGGTTAAATTCGATGTTGTCAAGGGAAGGCCAAGTAAATCAATCAATAGTCTTGGTCCTATTGAAAGTGAAGAATCAATTATATATAATATGAATAATAACATTCCTAGCCATAGAGATAGTTACAAATCTAGTTGTCGTACTGTTGATGATTTAGTCGGCATTTGGAATTTCATATATGATGACACTTTTTTAGTTAGGGATAGTAATAGCAGCAGTTATTCCATCTATTTGGATATTGAAAATCAAATTTTTAAGATTGACAATGATCCTTCTTTTGTAAGTGAACTAGAAAATTCTTTTTATAGTTTTCGAAACTCTACTTATCAAAATAATGTATCTAAGAGTGATGATTCTCACTATGATCAGTATATGTACGATACTAAATATAGTTGGAATAATCACATTAATAGTTGCATTAACAATTATCTTTAGACTCAAATCTGTATTGATAGTTACATTTTAAGTGATAGTCACAATTACAGTGATAGTTACATTTATAGTTCTATTTGTGCTTAAGGTGGAAATAGTAGTCAAA ATGGTTAAATTCGATGTTGTCAAGGGAAGGCCAAGTAAATCAATCAATAGTCTTGGTCCTATTGAAAGTGAAGAATCAATTATATATAATATGAATAATAACATTCCTAGCCATAGAGATAGTTACAAATCTAGTTGTCGTACTGTTGATGATTTAGTCGGCATTTGGAATTTCATATATGATGACACTTTTTTAGTTAGGGATAGTAATAGCAGCAGTTATTCCATCTATTTGGATATTGAAAATCAAATTTTTAAGATTGACAATGATCCTTCTTTTGTAAGTGAACTAGAAAATTCTTTTTATAGTTTTCGAAACTCTACTTATCAAAATAATGTATCTAAGAGTGATGATTCTCACTATGATCAGTATATGTACGATACTAAATATAGTTGGAATAATCACATTAATAGTTGCATTAACAATTATCTTTAG MVKFDVVKGRPSKSINSLGPIESEESIIYNMNNNIPSHRDSYKSSCRTVDDLVGIWNFIYDDTFLVRDSNSSSYSIYLDIENQIFKIDNDPSFVSELENSFYSFRNSTYQNNVSKSDDSHYDQYMYDTKYSWNNHINSCINNYL
BLAST of MELO3C034228.2 vs. NCBI nr
Match: YP_009325998.1 (acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus lanatus] >YP_009348040.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus mucosospermus] >YP_009431566.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus amarus] >APD52489.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus lanatus] >APW82470.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82555.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82640.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82725.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus mucosospermus] >APW82810.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus mucosospermus] >APW82895.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82980.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83065.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83150.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83235.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83320.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus mucosospermus] >ASY96155.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus amarus]) HSP 1 Score: 233.8 bits (595), Expect = 3.7e-58 Identity = 119/135 (88.15%), Postives = 125/135 (92.59%), Query Frame = 0
BLAST of MELO3C034228.2 vs. NCBI nr
Match: YP_009420803.1 (acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus colocynthis] >ASP44504.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus colocynthis]) HSP 1 Score: 233.8 bits (595), Expect = 3.7e-58 Identity = 119/135 (88.15%), Postives = 125/135 (92.59%), Query Frame = 0
BLAST of MELO3C034228.2 vs. NCBI nr
Match: YP_009431651.1 (acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus rehmii] >ASY96240.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus rehmii]) HSP 1 Score: 233.8 bits (595), Expect = 3.7e-58 Identity = 119/135 (88.15%), Postives = 125/135 (92.59%), Query Frame = 0
BLAST of MELO3C034228.2 vs. NCBI nr
Match: YP_009346493.1 (acetyl-CoA carboxylase carboxyltransferase beta subunit (chloroplast) [Cucumis x hytivus] >AOW71103.1 acetyl-CoA carboxylase carboxyltransferase beta subunit (chloroplast) [Cucumis x hytivus]) HSP 1 Score: 233.4 bits (594), Expect = 4.8e-58 Identity = 118/135 (87.41%), Postives = 125/135 (92.59%), Query Frame = 0
BLAST of MELO3C034228.2 vs. NCBI nr
Match: YP_004841792.1 (acetyl-CoA carboxylase carbosyltransferase beta subunit [Cucumis melo subsp. melo] >AEM76901.1 acetyl-CoA carboxylase carbosyltransferase beta subunit (chloroplast) [Cucumis melo subsp. melo] >ASY96321.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo subsp. agrestis] >ASY96408.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo subsp. agrestis] >ASY96495.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo subsp. agrestis] >ASY96582.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo var. conomon] >ASY96669.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo var. makuwa] >ASY96756.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo var. momordica] >ASY96843.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo var. dudaim] >ASY96930.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo var. cantalupo] >ASY97017.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo var. cantalupo] >ASY97104.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo var. inodorus] >ASY97191.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo var. cantalupo] >ASY97278.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo var. flexuosus] >ASY97365.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis melo var. flexuosus]) HSP 1 Score: 232.6 bits (592), Expect = 8.2e-58 Identity = 119/135 (88.15%), Postives = 124/135 (91.85%), Query Frame = 0
BLAST of MELO3C034228.2 vs. TAIR10
Match: ATCG00500.1 (acetyl-CoA carboxylase carboxyl transferase subunit beta) HSP 1 Score: 112.1 bits (279), Expect = 2.9e-25 Identity = 74/147 (50.34%), Postives = 95/147 (64.63%), Query Frame = 0
BLAST of MELO3C034228.2 vs. Swiss-Prot
Match: sp|Q2QD80|ACCD_CUCSA (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Cucumis sativus OX=3659 GN=accD PE=3 SV=2) HSP 1 Score: 232.3 bits (591), Expect = 3.5e-60 Identity = 117/135 (86.67%), Postives = 125/135 (92.59%), Query Frame = 0
BLAST of MELO3C034228.2 vs. Swiss-Prot
Match: sp|Q09X08|ACCD_MORIN (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Morus indica OX=248361 GN=accD PE=3 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 1.4e-40 Identity = 93/141 (65.96%), Postives = 110/141 (78.01%), Query Frame = 0
BLAST of MELO3C034228.2 vs. Swiss-Prot
Match: sp|B1A944|ACCD_CARPA (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Carica papaya OX=3649 GN=accD PE=3 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 1.4e-37 Identity = 92/144 (63.89%), Postives = 106/144 (73.61%), Query Frame = 0
BLAST of MELO3C034228.2 vs. Swiss-Prot
Match: sp|Q68RZ7|ACCD_PANGI (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Panax ginseng OX=4054 GN=accD PE=3 SV=2) HSP 1 Score: 155.2 bits (391), Expect = 5.4e-37 Identity = 88/140 (62.86%), Postives = 102/140 (72.86%), Query Frame = 0
BLAST of MELO3C034228.2 vs. Swiss-Prot
Match: sp|Q3C1J3|ACCD_NICSY (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Nicotiana sylvestris OX=4096 GN=accD PE=3 SV=2) HSP 1 Score: 152.1 bits (383), Expect = 4.6e-36 Identity = 82/136 (60.29%), Postives = 98/136 (72.06%), Query Frame = 0
BLAST of MELO3C034228.2 vs. TrEMBL
Match: tr|A0A1P8LF62|A0A1P8LF62_CITLA (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=accD PE=3 SV=1) HSP 1 Score: 233.8 bits (595), Expect = 2.4e-58 Identity = 119/135 (88.15%), Postives = 125/135 (92.59%), Query Frame = 0
BLAST of MELO3C034228.2 vs. TrEMBL
Match: tr|A0A1P8LFN2|A0A1P8LFN2_9ROSI (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Citrullus mucosospermus OX=519315 GN=accD PE=3 SV=1) HSP 1 Score: 233.8 bits (595), Expect = 2.4e-58 Identity = 119/135 (88.15%), Postives = 125/135 (92.59%), Query Frame = 0
BLAST of MELO3C034228.2 vs. TrEMBL
Match: tr|A0A249RX87|A0A249RX87_9ROSI (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Citrullus rehmii OX=260675 GN=accD PE=3 SV=1) HSP 1 Score: 233.8 bits (595), Expect = 2.4e-58 Identity = 119/135 (88.15%), Postives = 125/135 (92.59%), Query Frame = 0
BLAST of MELO3C034228.2 vs. TrEMBL
Match: tr|A0A249RWX9|A0A249RWX9_9ROSI (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Citrullus amarus OX=1567104 GN=accD PE=3 SV=1) HSP 1 Score: 233.8 bits (595), Expect = 2.4e-58 Identity = 119/135 (88.15%), Postives = 125/135 (92.59%), Query Frame = 0
BLAST of MELO3C034228.2 vs. TrEMBL
Match: tr|A0A1P8C7S8|A0A1P8C7S8_9ROSI (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Cucumis x hytivus OX=442738 GN=accD PE=3 SV=1) HSP 1 Score: 233.4 bits (594), Expect = 3.2e-58 Identity = 118/135 (87.41%), Postives = 125/135 (92.59%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|