MELO3C034226.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAGGGTAATTTGTCTTTTTGgctagtCAAACATGGACTGGTTCATAGATCTTTGGGTTTCGATTACCAAGGAATAGAGACTTTACAAATAAAGCCCGAGGAATGGCAcCgTATATTTTTTTTTGTAAAGAATAACAAAGCAAAGAACGAGTGAATCTTCATCAATTTTTCATTGTAAATGGGAAATACTTATAAAAATAAAAACAAAAAAGGGGGGTGGGGGAAGATAAAAAAGATGCAGGGTAATTTGTCTTTTTGGCTAGTTGAACATGAACTGATTCATAGATCTTTGGGTTTCGATTACCAAGGAATAGAGACTTTACAAATAAAGCCCAAGGATGGCACTCCATTGCAGCCATTTTATATGTATATGGTTACAATTATCTATGTTTTCCATGTGCTTATGATGTAACACCAGGTGGACTGTTAGCTAGTGTGTATCATCTTACGAGAATCGTGTATGGTATAGATCAACCGAAAGAG ATGCAGGGTAATTTGTCTTTTTGgctagtCAAACATGGACTGGTTCATAGATCTTTGGGTTTCGATTACCAAGGAATAGAGACTTTACAAATAAAGCCCAAGGATGGCACTCCATTGCAGCCATTTTATATGTATATGGTTACAATTATCTATGTTTTCCATGTGCTTATGATGTAACACCAGGTGGACTGTTAGCTAGTGTGTATCATCTTACGAGAATCGTGTATGGTATAGATCAACCGAAAGAG ATGCAGGGTAATTTGTCTTTTTGgctagtCAAACATGGACTGGTTCATAGATCTTTGGGTTTCGATTACCAAGGAATAGAGACTTTACAAATAAAGCCCAAGGATGGCACTCCATTGCAGCCATTTTATATGTATATGGTTACAATTATCTATGTTTTCCATGTGCTTATGATGTAA MQGNLSFWLVKHGLVHRSLGFDYQGIETLQIKPKDGTPLQPFYMYMVTIIYVFHVLMM
BLAST of MELO3C034226.2 vs. NCBI nr
Match: AFU94850.1 (NdhJ, partial (chloroplast) [Phyllanthus urinaria]) HSP 1 Score: 74.3 bits (181), Expect = 1.5e-10 Identity = 36/53 (67.92%), Postives = 40/53 (75.47%), Query Frame = 0
BLAST of MELO3C034226.2 vs. NCBI nr
Match: YP_009334178.1 (NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Caragana microphylla] >YP_009389918.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Caragana korshinskii] >APL97384.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Caragana microphylla] >APL97460.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Caragana korshinskii]) HSP 1 Score: 74.3 bits (181), Expect = 1.5e-10 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MELO3C034226.2 vs. NCBI nr
Match: YP_009437880.1 (NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Tibetia liangshanensis] >ATG33783.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Tibetia liangshanensis]) HSP 1 Score: 74.3 bits (181), Expect = 1.5e-10 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MELO3C034226.2 vs. NCBI nr
Match: ABG74843.1 (NADH dehydrogenase 19 kDa subunit (chloroplast) [Menodora longiflora]) HSP 1 Score: 73.9 bits (180), Expect = 2.0e-10 Identity = 35/46 (76.09%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MELO3C034226.2 vs. NCBI nr
Match: AOC32762.1 (NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Chuanminshen violaceum]) HSP 1 Score: 73.9 bits (180), Expect = 2.0e-10 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 0
BLAST of MELO3C034226.2 vs. TAIR10
Match: ATCG00420.1 (NADH dehydrogenase subunit J) HSP 1 Score: 66.6 bits (161), Expect = 5.7e-12 Identity = 33/53 (62.26%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of MELO3C034226.2 vs. Swiss-Prot
Match: sp|Q7FNS9|NDHJ_ATRBE (NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Atropa belladonna OX=33113 GN=ndhJ PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.1e-12 Identity = 34/46 (73.91%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MELO3C034226.2 vs. Swiss-Prot
Match: sp|Q3C1J9|NDHJ_NICSY (NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Nicotiana sylvestris OX=4096 GN=ndhJ PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.1e-12 Identity = 34/46 (73.91%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MELO3C034226.2 vs. Swiss-Prot
Match: sp|Q33C31|NDHJ_NICTO (NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Nicotiana tomentosiformis OX=4098 GN=ndhJ PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.1e-12 Identity = 34/46 (73.91%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MELO3C034226.2 vs. Swiss-Prot
Match: sp|Q2MII4|NDHJ_SOLBU (NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Solanum bulbocastanum OX=147425 GN=ndhJ PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.1e-12 Identity = 34/46 (73.91%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MELO3C034226.2 vs. Swiss-Prot
Match: sp|Q2MI97|NDHJ_SOLLC (NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Solanum lycopersicum OX=4081 GN=ndhJ PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.1e-12 Identity = 34/46 (73.91%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MELO3C034226.2 vs. TrEMBL
Match: tr|A0A1L5BWF5|A0A1L5BWF5_9FABA (NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Caragana microphylla OX=220690 GN=ndhJ PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 9.9e-11 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MELO3C034226.2 vs. TrEMBL
Match: tr|A0A291FIA2|A0A291FIA2_9FABA (NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Tibetia liangshanensis OX=1915067 GN=ndhJ PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 9.9e-11 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MELO3C034226.2 vs. TrEMBL
Match: tr|A0A1Z1CI44|A0A1Z1CI44_9FABA (NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Caragana korshinskii OX=220689 GN=ndhJ PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 9.9e-11 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 0
BLAST of MELO3C034226.2 vs. TrEMBL
Match: tr|K4K9C1|K4K9C1_PHYUR (NAD(P)H-quinone oxidoreductase (Fragment) OS=Phyllanthus urinaria OX=296035 GN=ndhJ PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 9.9e-11 Identity = 36/53 (67.92%), Postives = 40/53 (75.47%), Query Frame = 0
BLAST of MELO3C034226.2 vs. TrEMBL
Match: tr|Q06QV3|Q06QV3_9LAMI (NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Menodora longiflora OX=389177 GN=ndhJ PE=3 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.3e-10 Identity = 35/46 (76.09%), Postives = 38/46 (82.61%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|