MELO3C034119.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GAGACCCCACAAGCCCACATCTTCAAGGCTGATCTTCCCGGAATCAAGAAGGAAGAAGTGAAAGTAGAAGTGGAAGAAGGCAGAGTTTTGCAAATCAGTGGAGAGAGGAGCAAAGAGCAGGAGGAGAAGAATGACAAATGGCATAGAATTGAACGGAGCAGTGGGAAGTTCATGAGGAGATTTAGGCTGCCCGAGAATGCTAAAGTTGAGGA GAGACCCCACAAGCCCACATCTTCAAGGCTGATCTTCCCGGAATCAAGAAGGAAGAAGTGAAAGTAGAAGTGGAAGAAGGCAGAGTTTTGCAAATCAGTGGAGAGAGGAGCAAAGAGCAGGAGGAGAAGAATGACAAATGGCATAGAATTGAACGGAGCAGTGGGAAGTTCATGAGGAGATTTAGGCTGCCCGAGAATGCTAAAGTTGAGGA GAGACCCCACAAGCCCACATCTTCAAGGCTGATCTTCCCGGAATCAAGAAGGAAGAAGTGAAAGTAGAAGTGGAAGAAGGCAGAGTTTTGCAAATCAGTGGAGAGAGGAGCAAAGAGCAGGAGGAGAAGAATGACAAATGGCATAGAATTGAACGGAGCAGTGGGAAGTTCATGAGGAGATTTAGGCTGCCCGAGAATGCTAAAGTTGAG ETPQAHIFKADLPGIKKEEVKVEVEEGRVLQISGERSKEQEEKNDKWHRIERSSGKFMRRFRLPENAKVE
BLAST of MELO3C034119.2 vs. NCBI nr
Match: XP_004149942.2 (PREDICTED: 17.8 kDa class I heat shock protein-like [Cucumis sativus] >KGN50612.1 Chloroplast small heat shock protein class I [Cucumis sativus]) HSP 1 Score: 137.5 bits (345), Expect = 1.7e-29 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C034119.2 vs. NCBI nr
Match: XP_008463198.1 (PREDICTED: 18.1 kDa class I heat shock protein-like [Cucumis melo]) HSP 1 Score: 137.5 bits (345), Expect = 1.7e-29 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C034119.2 vs. NCBI nr
Match: XP_022139109.1 (18.1 kDa class I heat shock protein-like [Momordica charantia] >XP_022159337.1 18.1 kDa class I heat shock protein-like [Momordica charantia]) HSP 1 Score: 137.5 bits (345), Expect = 1.7e-29 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C034119.2 vs. NCBI nr
Match: XP_022138990.1 (17.8 kDa class I heat shock protein-like isoform X1 [Momordica charantia] >XP_022138991.1 17.8 kDa class I heat shock protein-like isoform X2 [Momordica charantia]) HSP 1 Score: 136.0 bits (341), Expect = 5.1e-29 Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C034119.2 vs. NCBI nr
Match: XP_023529998.1 (17.8 kDa class I heat shock protein-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 136.0 bits (341), Expect = 5.1e-29 Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C034119.2 vs. TAIR10
Match: AT5G59720.1 (heat shock protein 18.2) HSP 1 Score: 124.4 bits (311), Expect = 2.8e-29 Identity = 60/70 (85.71%), Postives = 67/70 (95.71%), Query Frame = 0
BLAST of MELO3C034119.2 vs. TAIR10
Match: AT1G53540.1 (HSP20-like chaperones superfamily protein) HSP 1 Score: 122.9 bits (307), Expect = 8.0e-29 Identity = 58/70 (82.86%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of MELO3C034119.2 vs. TAIR10
Match: AT3G46230.1 (heat shock protein 17.4) HSP 1 Score: 122.1 bits (305), Expect = 1.4e-28 Identity = 58/70 (82.86%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of MELO3C034119.2 vs. TAIR10
Match: AT2G29500.1 (HSP20-like chaperones superfamily protein) HSP 1 Score: 110.5 bits (275), Expect = 4.1e-25 Identity = 52/70 (74.29%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of MELO3C034119.2 vs. TAIR10
Match: AT1G07400.1 (HSP20-like chaperones superfamily protein) HSP 1 Score: 102.4 bits (254), Expect = 1.1e-22 Identity = 48/70 (68.57%), Postives = 61/70 (87.14%), Query Frame = 0
BLAST of MELO3C034119.2 vs. Swiss-Prot
Match: sp|P27396|HSP11_DAUCA (17.8 kDa class I heat shock protein OS=Daucus carota OX=4039 PE=3 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 2.6e-29 Identity = 61/70 (87.14%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C034119.2 vs. Swiss-Prot
Match: sp|P19037|HS181_ARATH (18.1 kDa class I heat shock protein OS=Arabidopsis thaliana OX=3702 GN=HSP18.1 PE=1 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 5.0e-28 Identity = 60/70 (85.71%), Postives = 67/70 (95.71%), Query Frame = 0
BLAST of MELO3C034119.2 vs. Swiss-Prot
Match: sp|Q84Q72|HS181_ORYSJ (18.1 kDa class I heat shock protein OS=Oryza sativa subsp. japonica OX=39947 GN=HSP18.1 PE=2 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.1e-27 Identity = 59/70 (84.29%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of MELO3C034119.2 vs. Swiss-Prot
Match: sp|P27777|HS16A_ORYSJ (16.9 kDa class I heat shock protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=HSP16.9A PE=1 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 1.4e-27 Identity = 58/70 (82.86%), Postives = 68/70 (97.14%), Query Frame = 0
BLAST of MELO3C034119.2 vs. Swiss-Prot
Match: sp|Q943E6|HS16B_ORYSJ (16.9 kDa class I heat shock protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=HSP16.9B PE=2 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 1.4e-27 Identity = 58/70 (82.86%), Postives = 68/70 (97.14%), Query Frame = 0
BLAST of MELO3C034119.2 vs. TrEMBL
Match: tr|A0A1S3CIN2|A0A1S3CIN2_CUCME (18.1 kDa class I heat shock protein-like OS=Cucumis melo OX=3656 GN=LOC103501408 PE=3 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 1.1e-29 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C034119.2 vs. TrEMBL
Match: tr|A0A0A0KQE2|A0A0A0KQE2_CUCSA (Chloroplast small heat shock protein class I OS=Cucumis sativus OX=3659 GN=Csa_5G190560 PE=3 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 1.1e-29 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C034119.2 vs. TrEMBL
Match: tr|A0A0A0KLU0|A0A0A0KLU0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G197620 PE=3 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 4.4e-29 Identity = 69/70 (98.57%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of MELO3C034119.2 vs. TrEMBL
Match: tr|A0A1S3CQK2|A0A1S3CQK2_CUCME (17.6 kDa class I heat shock protein 3-like OS=Cucumis melo OX=3656 GN=LOC103503166 PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 7.4e-29 Identity = 68/70 (97.14%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of MELO3C034119.2 vs. TrEMBL
Match: tr|A0A0A0KSB4|A0A0A0KSB4_CUCSA (Chloroplast small heat shock protein class I OS=Cucumis sativus OX=3659 GN=Csa_5G190550 PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 9.7e-29 Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|