MELO3C033851.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAACATTCGTCGGCACGAAATGTCATCGAAAGAGCATTTGGGTTGTTAAAAGGTCGCTGGGCAATTTTAAGAGGAAAGTCATACTACCCAGTCGATGTCCAATGTCGAACAATCATGGTGTGTTGTCTGCTACACAATCTTATCAATAGAGAGATGACTAACAGTGAAATAATTGATGATTTGGATGAGGGTGATTCAACATACGCTACAACTGGAGGTGACGAGATTAATTACATTGAGGCTTCAAACGAATGGAGTGAATAG ATGAAACATTCGTCGGCACGAAATGTCATCGAAAGAGCATTTGGGTTGTTAAAAGGTCGCTGGGCAATTTTAAGAGGAAAGTCATACTACCCAGTCGATGTCCAATGTCGAACAATCATGGTGTGTTGTCTGCTACACAATCTTATCAATAGAGAGATGACTAACAGTGAAATAATTGATGATTTGGATGAGGGTGATTCAACATACGCTACAACTGGAGGTGACGAGATTAATTACATTGAGGCTTCAAACGAATGGAGTGAATAG ATGAAACATTCGTCGGCACGAAATGTCATCGAAAGAGCATTTGGGTTGTTAAAAGGTCGCTGGGCAATTTTAAGAGGAAAGTCATACTACCCAGTCGATGTCCAATGTCGAACAATCATGGTGTGTTGTCTGCTACACAATCTTATCAATAGAGAGATGACTAACAGTGAAATAATTGATGATTTGGATGAGGGTGATTCAACATACGCTACAACTGGAGGTGACGAGATTAATTACATTGAGGCTTCAAACGAATGGAGTGAATAG MKHSSARNVIERAFGLLKGRWAILRGKSYYPVDVQCRTIMVCCLLHNLINREMTNSEIIDDLDEGDSTYATTGGDEINYIEASNEWSE
BLAST of MELO3C033851.2 vs. NCBI nr
Match: XP_008441953.1 (PREDICTED: uncharacterized protein LOC103485952 [Cucumis melo]) HSP 1 Score: 175.3 bits (443), Expect = 9.5e-41 Identity = 83/88 (94.32%), Postives = 84/88 (95.45%), Query Frame = 0
BLAST of MELO3C033851.2 vs. NCBI nr
Match: XP_008466673.1 (PREDICTED: uncharacterized protein LOC103504027 [Cucumis melo]) HSP 1 Score: 166.4 bits (420), Expect = 4.4e-38 Identity = 80/88 (90.91%), Postives = 83/88 (94.32%), Query Frame = 0
BLAST of MELO3C033851.2 vs. NCBI nr
Match: ADN34114.1 (retrotransposon protein [Cucumis melo subsp. melo]) HSP 1 Score: 151.8 bits (382), Expect = 1.1e-33 Identity = 70/88 (79.55%), Postives = 80/88 (90.91%), Query Frame = 0
BLAST of MELO3C033851.2 vs. NCBI nr
Match: XP_011659758.1 (PREDICTED: putative nuclease HARBI1 [Cucumis sativus]) HSP 1 Score: 151.8 bits (382), Expect = 1.1e-33 Identity = 70/88 (79.55%), Postives = 79/88 (89.77%), Query Frame = 0
BLAST of MELO3C033851.2 vs. NCBI nr
Match: XP_016902382.1 (PREDICTED: uncharacterized protein LOC107991657 [Cucumis melo]) HSP 1 Score: 150.2 bits (378), Expect = 3.3e-33 Identity = 70/88 (79.55%), Postives = 80/88 (90.91%), Query Frame = 0
BLAST of MELO3C033851.2 vs. TAIR10
Match: AT5G35695.1 (Putative harbinger transposase-derived nuclease (InterPro:IPR006912)) HSP 1 Score: 50.1 bits (118), Expect = 8.3e-07 Identity = 21/57 (36.84%), Postives = 32/57 (56.14%), Query Frame = 0
BLAST of MELO3C033851.2 vs. TAIR10
Match: AT3G55350.1 (PIF / Ping-Pong family of plant transposases) HSP 1 Score: 43.1 bits (100), Expect = 1.0e-04 Identity = 21/49 (42.86%), Postives = 27/49 (55.10%), Query Frame = 0
BLAST of MELO3C033851.2 vs. TAIR10
Match: AT3G19120.1 (PIF / Ping-Pong family of plant transposases) HSP 1 Score: 41.6 bits (96), Expect = 3.0e-04 Identity = 28/60 (46.67%), Postives = 36/60 (60.00%), Query Frame = 0
BLAST of MELO3C033851.2 vs. TAIR10
Match: AT5G12010.1 (unknown protein) HSP 1 Score: 41.2 bits (95), Expect = 3.9e-04 Identity = 22/66 (33.33%), Postives = 32/66 (48.48%), Query Frame = 0
BLAST of MELO3C033851.2 vs. TrEMBL
Match: tr|A0A1S3B4J8|A0A1S3B4J8_CUCME (uncharacterized protein LOC103485952 OS=Cucumis melo OX=3656 GN=LOC103485952 PE=4 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 6.3e-41 Identity = 83/88 (94.32%), Postives = 84/88 (95.45%), Query Frame = 0
BLAST of MELO3C033851.2 vs. TrEMBL
Match: tr|A0A1S3CRU3|A0A1S3CRU3_CUCME (uncharacterized protein LOC103504027 OS=Cucumis melo OX=3656 GN=LOC103504027 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 2.9e-38 Identity = 80/88 (90.91%), Postives = 83/88 (94.32%), Query Frame = 0
BLAST of MELO3C033851.2 vs. TrEMBL
Match: tr|E5GCB5|E5GCB5_CUCME (Retrotransposon protein OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 7.4e-34 Identity = 70/88 (79.55%), Postives = 80/88 (90.91%), Query Frame = 0
BLAST of MELO3C033851.2 vs. TrEMBL
Match: tr|A0A1S4E2C9|A0A1S4E2C9_CUCME (uncharacterized protein LOC107991657 OS=Cucumis melo OX=3656 GN=LOC107991657 PE=4 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 2.2e-33 Identity = 70/88 (79.55%), Postives = 80/88 (90.91%), Query Frame = 0
BLAST of MELO3C033851.2 vs. TrEMBL
Match: tr|A0A1S3C5E3|A0A1S3C5E3_CUCME (uncharacterized protein LOC103496660 OS=Cucumis melo OX=3656 GN=LOC103496660 PE=4 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 8.2e-33 Identity = 70/82 (85.37%), Postives = 75/82 (91.46%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|