MELO3C033614.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.GCTCTACATCACCGTGTTCTTTTACCAAATCCCAATTCATTTCTACTCTTCACAGCCAAGGCAAGCTCAAATATATCATTGAAGCCATCAAATTTCGAGAAGGATTTGATGCTGCCGGTGTCGGATCCTCCTCGCAGCACTGAAGAGAAAGACCGATTGATCAGAGGCGATGAGAAGCTCTCTAGAGGATCCTCCATGACCAAACGAGGAGCCTATGTTGCTCTCTCTTACACGGCTTACAGATGCGCGTAA GCTCTACATCACCGTGTTCTTTTACCAAATCCCAATTCATTTCTACTCTTCACAGCCAAGGCAAGCTCAAATATATCATTGAAGCCATCAAATTTCGAGAAGGATTTGATGCTGCCGGTGTCGGATCCTCCTCGCAGCACTGAAGAGAAAGACCGATTGATCAGAGGCGATGAGAAGCTCTCTAGAGGATCCTCCATGACCAAACGAGGAGCCTATGTTGCTCTCTCTTACACGGCTTACAGATGCGCGTAA GCTCTACATCACCGTGTTCTTTTACCAAATCCCAATTCATTTCTACTCTTCACAGCCAAGGCAAGCTCAAATATATCATTGAAGCCATCAAATTTCGAGAAGGATTTGATGCTGCCGGTGTCGGATCCTCCTCGCAGCACTGAAGAGAAAGACCGATTGATCAGAGGCGATGAGAAGCTCTCTAGAGGATCCTCCATGACCAAACGAGGAGCCTATGTTGCTCTCTCTTACACGGCTTACAGATGCGCGTAA ALHHRVLLPNPNSFLLFTAKASSNISLKPSNFEKDLMLPVSDPPRSTEEKDRLIRGDEKLSRGSSMTKRGAYVALSYTAYRCA
BLAST of MELO3C033614.2 vs. NCBI nr
Match: XP_008466419.1 (PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Cucumis melo]) HSP 1 Score: 90.9 bits (224), Expect = 2.2e-15 Identity = 46/55 (83.64%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C033614.2 vs. NCBI nr
Match: XP_011652478.1 (PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Cucumis sativus] >KGN60093.1 hypothetical protein Csa_3G877640 [Cucumis sativus]) HSP 1 Score: 90.5 bits (223), Expect = 2.9e-15 Identity = 46/55 (83.64%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C033614.2 vs. NCBI nr
Match: XP_022142379.1 (nucleotide-sugar uncharacterized transporter 3 [Momordica charantia]) HSP 1 Score: 85.1 bits (209), Expect = 1.2e-13 Identity = 43/55 (78.18%), Postives = 48/55 (87.27%), Query Frame = 0
BLAST of MELO3C033614.2 vs. NCBI nr
Match: XP_022937346.1 (nucleotide-sugar uncharacterized transporter 3 [Cucurbita moschata]) HSP 1 Score: 84.7 bits (208), Expect = 1.6e-13 Identity = 43/55 (78.18%), Postives = 48/55 (87.27%), Query Frame = 0
BLAST of MELO3C033614.2 vs. NCBI nr
Match: XP_022976174.1 (nucleotide-sugar uncharacterized transporter 3 [Cucurbita maxima]) HSP 1 Score: 84.7 bits (208), Expect = 1.6e-13 Identity = 43/55 (78.18%), Postives = 48/55 (87.27%), Query Frame = 0
BLAST of MELO3C033614.2 vs. TAIR10
Match: AT4G32272.2 (Nucleotide/sugar transporter family protein) HSP 1 Score: 45.4 bits (106), Expect = 1.9e-05 Identity = 24/43 (55.81%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of MELO3C033614.2 vs. Swiss-Prot
Match: sp|A8MRY9|NSTU3_ARATH (Nucleotide-sugar uncharacterized transporter 3 OS=Arabidopsis thaliana OX=3702 GN=At4g32272 PE=2 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 3.5e-04 Identity = 24/43 (55.81%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of MELO3C033614.2 vs. TrEMBL
Match: tr|A0A1S3CR80|A0A1S3CR80_CUCME (putative UDP-sugar transporter DDB_G0278631 OS=Cucumis melo OX=3656 GN=LOC103503832 PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.5e-15 Identity = 46/55 (83.64%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C033614.2 vs. TrEMBL
Match: tr|A0A0A0LEB6|A0A0A0LEB6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G877640 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.9e-15 Identity = 46/55 (83.64%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C033614.2 vs. TrEMBL
Match: tr|A0A2P5E782|A0A2P5E782_9ROSA (Ubiquitin-related domain containing protein OS=Trema orientalis OX=63057 GN=TorRG33x02_227620 PE=4 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 2.0e-09 Identity = 35/53 (66.04%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of MELO3C033614.2 vs. TrEMBL
Match: tr|A0A2P5DDJ2|A0A2P5DDJ2_PARAD (Ubiquitin-related domain containing protein OS=Parasponia andersonii OX=3476 GN=PanWU01x14_074940 PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 1.7e-08 Identity = 34/53 (64.15%), Postives = 45/53 (84.91%), Query Frame = 0
BLAST of MELO3C033614.2 vs. TrEMBL
Match: tr|A0A2I4E0G6|A0A2I4E0G6_9ROSI (putative UDP-sugar transporter DDB_G0278631 OS=Juglans regia OX=51240 GN=LOC108985152 PE=4 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 1.1e-07 Identity = 32/53 (60.38%), Postives = 44/53 (83.02%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|