MELO3C033100.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAAGTACCAAATTATTAAGGATTTGGGAGCTGGAAGTTTTGGTGTTGCAAAACTTTGTCGGCATCAAGAGACCAAAGAACTTGTAGCCATCAAGTTCATAGAACGTGGTCCGCAGGTTGATTCTCTTCTCACTTTGTGTCCTTCACCTTTCAAATTAATCAACCCTTTTTTCCTTTTCTTTCTTTGATCTAACCGGGTGTCAGAGCCAGGTCGATGAGAATGTGGAAAGAGAGATTATAAACCATCGATCCCTTCGACATCCAAATGTCATTCGTTTCAAGGAGGCAAGTAATTAGTTTCTTTTTCTTTTTCTTTTTAATTACTTCCAAACTTTGTTCTCATCTCATCCGTGAGATCAGATTGAAAAATGAATCAATTTAAGAAATGAAGGGTTGGAGGTTTAATATTTGCAGGTCATCTTAACCACGACCCACTTGGGTATGGTGATGGAATATGCTCATGGGGGAGAACTTTTCGAAAGAATTTACTATGGTGGTCGTTTTTCAGAAGATGAGGTCTGTTATCTACCTATTACTGATCTCTCTATGTTTCATATACAACTCCTTTCATTCAACTTCTTTAA ATGGAGAAGTACCAAATTATTAAGGATTTGGGAGCTGGAAGTTTTGGTGTTGCAAAACTTTGTCGGCATCAAGAGACCAAAGAACTTGTAGCCATCAAGTTCATAGAACGTGGTCCGCAGGTCATCTTAACCACGACCCACTTGGGTATGGTGATGGAATATGCTCATGGGGGAGAACTTTTCGAAAGAATTTACTATGGTGGTCGTTTTTCAGAAGATGAGGTCTGTTATCTACCTATTACTGATCTCTCTATGTTTCATATACAACTCCTTTCATTCAACTTCTTTAA ATGGAGAAGTACCAAATTATTAAGGATTTGGGAGCTGGAAGTTTTGGTGTTGCAAAACTTTGTCGGCATCAAGAGACCAAAGAACTTGTAGCCATCAAGTTCATAGAACGTGGTCCGCAGGTCATCTTAACCACGACCCACTTGGGTATGGTGATGGAATATGCTCATGGGGGAGAACTTTTCGAAAGAATTTACTATGGTGGTCGTTTTTCAGAAGATGAGGTCTGTTATCTACCTATTACTGATCTCTCTATGTTTCATATACAACTCCTTTCATTCAACTTCTTT MEKYQIIKDLGAGSFGVAKLCRHQETKELVAIKFIERGPQVILTTTHLGMVMEYAHGGELFERIYYGGRFSEDEVCYLPITDLSMFHIQLLSFNFF
BLAST of MELO3C033100.2 vs. NCBI nr
Match: XP_008442076.1 (PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis melo]) HSP 1 Score: 186.0 bits (471), Expect = 5.8e-44 Identity = 96/121 (79.34%), Postives = 96/121 (79.34%), Query Frame = 0
BLAST of MELO3C033100.2 vs. NCBI nr
Match: XP_008456157.1 (PREDICTED: serine/threonine-protein kinase SRK2H-like isoform X1 [Cucumis melo]) HSP 1 Score: 132.5 bits (332), Expect = 7.7e-28 Identity = 70/102 (68.63%), Postives = 72/102 (70.59%), Query Frame = 0
BLAST of MELO3C033100.2 vs. NCBI nr
Match: XP_008456158.1 (PREDICTED: serine/threonine-protein kinase SRK2H-like isoform X2 [Cucumis melo]) HSP 1 Score: 132.5 bits (332), Expect = 7.7e-28 Identity = 70/102 (68.63%), Postives = 72/102 (70.59%), Query Frame = 0
BLAST of MELO3C033100.2 vs. NCBI nr
Match: OMP10683.1 (hypothetical protein COLO4_04355 [Corchorus olitorius]) HSP 1 Score: 120.6 bits (301), Expect = 3.0e-24 Identity = 56/77 (72.73%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of MELO3C033100.2 vs. NCBI nr
Match: PPD92352.1 (hypothetical protein GOBAR_DD10717 [Gossypium barbadense]) HSP 1 Score: 118.2 bits (295), Expect = 1.5e-23 Identity = 54/77 (70.13%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of MELO3C033100.2 vs. TAIR10
Match: AT5G63650.1 (SNF1-related protein kinase 2.5) HSP 1 Score: 104.0 bits (258), Expect = 5.3e-23 Identity = 55/102 (53.92%), Postives = 66/102 (64.71%), Query Frame = 0
BLAST of MELO3C033100.2 vs. TAIR10
Match: AT5G08590.1 (SNF1-related protein kinase 2.1) HSP 1 Score: 100.9 bits (250), Expect = 4.5e-22 Identity = 53/102 (51.96%), Postives = 65/102 (63.73%), Query Frame = 0
BLAST of MELO3C033100.2 vs. TAIR10
Match: AT1G60940.1 (SNF1-related protein kinase 2.10) HSP 1 Score: 98.2 bits (243), Expect = 2.9e-21 Identity = 50/102 (49.02%), Postives = 65/102 (63.73%), Query Frame = 0
BLAST of MELO3C033100.2 vs. TAIR10
Match: AT1G10940.2 (Protein kinase superfamily protein) HSP 1 Score: 96.3 bits (238), Expect = 1.1e-20 Identity = 49/99 (49.49%), Postives = 64/99 (64.65%), Query Frame = 0
BLAST of MELO3C033100.2 vs. TAIR10
Match: AT2G23030.1 (SNF1-related protein kinase 2.9) HSP 1 Score: 96.3 bits (238), Expect = 1.1e-20 Identity = 51/102 (50.00%), Postives = 65/102 (63.73%), Query Frame = 0
BLAST of MELO3C033100.2 vs. Swiss-Prot
Match: sp|Q9FFP9|SRK2H_ARATH (Serine/threonine-protein kinase SRK2H OS=Arabidopsis thaliana OX=3702 GN=SRK2H PE=1 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 9.5e-22 Identity = 55/102 (53.92%), Postives = 66/102 (64.71%), Query Frame = 0
BLAST of MELO3C033100.2 vs. Swiss-Prot
Match: sp|P43292|SRK2G_ARATH (Serine/threonine-protein kinase SRK2G OS=Arabidopsis thaliana OX=3702 GN=SRK2G PE=1 SV=2) HSP 1 Score: 100.9 bits (250), Expect = 8.1e-21 Identity = 53/102 (51.96%), Postives = 65/102 (63.73%), Query Frame = 0
BLAST of MELO3C033100.2 vs. Swiss-Prot
Match: sp|Q9C958|SRK2B_ARATH (Serine/threonine-protein kinase SRK2B OS=Arabidopsis thaliana OX=3702 GN=SRK2B PE=1 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 5.2e-20 Identity = 50/102 (49.02%), Postives = 65/102 (63.73%), Query Frame = 0
BLAST of MELO3C033100.2 vs. Swiss-Prot
Match: sp|A2YNT8|SAPK2_ORYSI (Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica OX=39946 GN=SAPK2 PE=2 SV=2) HSP 1 Score: 97.8 bits (242), Expect = 6.8e-20 Identity = 52/99 (52.53%), Postives = 62/99 (62.63%), Query Frame = 0
BLAST of MELO3C033100.2 vs. Swiss-Prot
Match: sp|Q0D4J7|SAPK2_ORYSJ (Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica OX=39947 GN=SAPK2 PE=1 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 6.8e-20 Identity = 52/99 (52.53%), Postives = 62/99 (62.63%), Query Frame = 0
BLAST of MELO3C033100.2 vs. TrEMBL
Match: tr|A0A1S3B5I7|A0A1S3B5I7_CUCME (serine/threonine-protein kinase SRK2H-like OS=Cucumis melo OX=3656 GN=LOC103486041 PE=4 SV=1) HSP 1 Score: 186.0 bits (471), Expect = 3.9e-44 Identity = 96/121 (79.34%), Postives = 96/121 (79.34%), Query Frame = 0
BLAST of MELO3C033100.2 vs. TrEMBL
Match: tr|A0A1S3C2K4|A0A1S3C2K4_CUCME (serine/threonine-protein kinase SRK2H-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103496177 PE=3 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 5.1e-28 Identity = 70/102 (68.63%), Postives = 72/102 (70.59%), Query Frame = 0
BLAST of MELO3C033100.2 vs. TrEMBL
Match: tr|A0A1S3C399|A0A1S3C399_CUCME (serine/threonine-protein kinase SRK2H-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103496177 PE=3 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 5.1e-28 Identity = 70/102 (68.63%), Postives = 72/102 (70.59%), Query Frame = 0
BLAST of MELO3C033100.2 vs. TrEMBL
Match: tr|A0A1R3KUA6|A0A1R3KUA6_9ROSI (Uncharacterized protein OS=Corchorus olitorius OX=93759 GN=COLO4_04355 PE=3 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 2.0e-24 Identity = 56/77 (72.73%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of MELO3C033100.2 vs. TrEMBL
Match: tr|A0A2N9IRV6|A0A2N9IRV6_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS55120 PE=3 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 5.8e-24 Identity = 55/77 (71.43%), Postives = 67/77 (87.01%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|