MELO3C033073.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.TGGCTAGCACTCTCCCTTTCTCCAATCCTCATCATTATACAGTTGGTCCACTTCACATGATGGTCAAACAAATTGAGGATGAAAAAACAAGAGCAGTAGGTTCAAATCTTTGGGTGGAGGAATCTGAATGCATTGAATGGTTGAATTCAAAGGAACCCAATTCTGTGGTTTATGTTAACTTTGGTAGCATCACAGTGATGACAAAACAAGTAGTACTGAAGTTTCGGGCACAAAAACCCCATATGGAAGAACATTAA TGGCTAGCACTCTCCCTTTCTCCAATCCTCATCATTATACAGTTGGTCCACTTCACATGATGGTCAAACAAATTGAGGATGAAAAAACAAGAGCAGTAGGTTCAAATCTTTGGGTGGAGGAATCTGAATGCATTGAATGGTTGAATTCAAAGGAACCCAATTCTGTGGTTTATGTTAACTTTGGTAGCATCACAGTGATGACAAAACAAGTAGTACTGAAGTTTCGGGCACAAAAACCCCATATGGAAGAACATTAA ATGATGGTCAAACAAATTGAGGATGAAAAAACAAGAGCAGTAGGTTCAAATCTTTGGGTGGAGGAATCTGAATGCATTGAATGGTTGAATTCAAAGGAACCCAATTCTGTGGTTTATGTTAACTTTGGTAGCATCACAGTGATGACAAAACAAGTAGTACTGAAGTTTCGGGCACAAAAACCCCATATGGAAGAACATTAA MMVKQIEDEKTRAVGSNLWVEESECIEWLNSKEPNSVVYVNFGSITVMTKQVVLKFRAQKPHMEEH
BLAST of MELO3C033073.2 vs. NCBI nr
Match: XP_008455194.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis melo]) HSP 1 Score: 107.1 bits (266), Expect = 2.4e-20 Identity = 50/56 (89.29%), Postives = 55/56 (98.21%), Query Frame = 0
BLAST of MELO3C033073.2 vs. NCBI nr
Match: XP_016901691.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis melo]) HSP 1 Score: 106.7 bits (265), Expect = 3.1e-20 Identity = 50/56 (89.29%), Postives = 55/56 (98.21%), Query Frame = 0
BLAST of MELO3C033073.2 vs. NCBI nr
Match: XP_008455180.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis melo]) HSP 1 Score: 104.8 bits (260), Expect = 1.2e-19 Identity = 49/56 (87.50%), Postives = 54/56 (96.43%), Query Frame = 0
BLAST of MELO3C033073.2 vs. NCBI nr
Match: XP_011659716.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis sativus]) HSP 1 Score: 104.8 bits (260), Expect = 1.2e-19 Identity = 49/56 (87.50%), Postives = 54/56 (96.43%), Query Frame = 0
BLAST of MELO3C033073.2 vs. NCBI nr
Match: XP_011658788.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform X1 [Cucumis sativus]) HSP 1 Score: 102.4 bits (254), Expect = 5.8e-19 Identity = 46/56 (82.14%), Postives = 53/56 (94.64%), Query Frame = 0
BLAST of MELO3C033073.2 vs. TAIR10
Match: AT1G22380.1 (UDP-glucosyl transferase 85A3) HSP 1 Score: 69.3 bits (168), Expect = 9.9e-13 Identity = 31/50 (62.00%), Postives = 39/50 (78.00%), Query Frame = 0
BLAST of MELO3C033073.2 vs. TAIR10
Match: AT1G22370.2 (UDP-glucosyl transferase 85A5) HSP 1 Score: 66.2 bits (160), Expect = 8.4e-12 Identity = 27/50 (54.00%), Postives = 40/50 (80.00%), Query Frame = 0
BLAST of MELO3C033073.2 vs. TAIR10
Match: AT1G22360.1 (UDP-glucosyl transferase 85A2) HSP 1 Score: 63.9 bits (154), Expect = 4.2e-11 Identity = 27/42 (64.29%), Postives = 37/42 (88.10%), Query Frame = 0
BLAST of MELO3C033073.2 vs. TAIR10
Match: AT1G22400.1 (UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 59.3 bits (142), Expect = 1.0e-09 Identity = 24/50 (48.00%), Postives = 38/50 (76.00%), Query Frame = 0
BLAST of MELO3C033073.2 vs. TAIR10
Match: AT1G78270.1 (UDP-glucosyl transferase 85A4) HSP 1 Score: 58.9 bits (141), Expect = 1.3e-09 Identity = 23/50 (46.00%), Postives = 39/50 (78.00%), Query Frame = 0
BLAST of MELO3C033073.2 vs. Swiss-Prot
Match: sp|F8WLS6|UGT6_CATRO (7-deoxyloganetin glucosyltransferase OS=Catharanthus roseus OX=4058 GN=UGT85A23 PE=1 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.7e-14 Identity = 33/56 (58.93%), Postives = 46/56 (82.14%), Query Frame = 0
BLAST of MELO3C033073.2 vs. Swiss-Prot
Match: sp|F8WKW1|UGT2_GARJA (7-deoxyloganetin glucosyltransferase OS=Gardenia jasminoides OX=114476 GN=UGT85A24 PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 6.6e-14 Identity = 33/53 (62.26%), Postives = 45/53 (84.91%), Query Frame = 0
BLAST of MELO3C033073.2 vs. Swiss-Prot
Match: sp|Q6VAB3|U85A8_STERE (UDP-glycosyltransferase 85A8 OS=Stevia rebaudiana OX=55670 GN=UGT85A8 PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 7.3e-13 Identity = 33/57 (57.89%), Postives = 47/57 (82.46%), Query Frame = 0
BLAST of MELO3C033073.2 vs. Swiss-Prot
Match: sp|Q9LMF1|U85A3_ARATH (UDP-glycosyltransferase 85A3 OS=Arabidopsis thaliana OX=3702 GN=UGT85A3 PE=2 SV=2) HSP 1 Score: 69.3 bits (168), Expect = 1.8e-11 Identity = 31/50 (62.00%), Postives = 39/50 (78.00%), Query Frame = 0
BLAST of MELO3C033073.2 vs. Swiss-Prot
Match: sp|Q6VAA4|U85C1_STERE (UDP-glycosyltransferase 85C1 OS=Stevia rebaudiana OX=55670 GN=UGT85C1 PE=2 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 3.1e-11 Identity = 30/56 (53.57%), Postives = 43/56 (76.79%), Query Frame = 0
BLAST of MELO3C033073.2 vs. TrEMBL
Match: tr|A0A1S3C0B9|A0A1S3C0B9_CUCME (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495416 PE=3 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.6e-20 Identity = 50/56 (89.29%), Postives = 55/56 (98.21%), Query Frame = 0
BLAST of MELO3C033073.2 vs. TrEMBL
Match: tr|A0A1S4E0D7|A0A1S4E0D7_CUCME (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495415 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 2.0e-20 Identity = 50/56 (89.29%), Postives = 55/56 (98.21%), Query Frame = 0
BLAST of MELO3C033073.2 vs. TrEMBL
Match: tr|A0A1S3C1J4|A0A1S3C1J4_CUCME (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495412 PE=3 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 7.8e-20 Identity = 49/56 (87.50%), Postives = 54/56 (96.43%), Query Frame = 0
BLAST of MELO3C033073.2 vs. TrEMBL
Match: tr|A0A0A0K416|A0A0A0K416_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G063980 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.4e-16 Identity = 41/56 (73.21%), Postives = 51/56 (91.07%), Query Frame = 0
BLAST of MELO3C033073.2 vs. TrEMBL
Match: tr|A0A1S3C1K5|A0A1S3C1K5_CUCME (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495418 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 6.8e-16 Identity = 41/56 (73.21%), Postives = 48/56 (85.71%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|