MELO3C033030.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.TGACACTTTTTGATGTGATGTAATTTACTGTGTTGATTACTCGGATTGGTTACATATTCTATCTTTCAAGAATTTTCAGAGTGAAGCTGAAATGCAAGGAACATGCGCAAGGCAGTCGCAGGCAAGGAAAGAGGTAGAGACGTATGAAGAAGATAAAGACGAGCACAGTGACATCTTATGTAGGGCATGCGGTGAGAACTATGCTTCAGATGAATTTTGGATTTGTTGTGATATCTATGAGAAATGGTTCCATGGGAAATTTGTTGTATGA TGACACTTTTTGATGTGATGTAATTTACTGTGTTGATTACTCGGATTGGTTACATATTCTATCTTTCAAGAATTTTCAGAGTGAAGCTGAAATGCAAGGAACATGCGCAAGGCAGTCGCAGGCAAGGAAAGAGGTAGAGACGTATGAAGAAGATAAAGACGAGCACAGTGACATCTTATGTAGGGCATGCGGTGAGAACTATGCTTCAGATGAATTTTGGATTTGTTGTGATATCTATGAGAAATGGTTCCATGGGAAATTTGTTGTATGA ATGCAAGGAACATGCGCAAGGCAGTCGCAGGCAAGGAAAGAGGTAGAGACGTATGAAGAAGATAAAGACGAGCACAGTGACATCTTATGTAGGGCATGCGGTGAGAACTATGCTTCAGATGAATTTTGGATTTGTTGTGATATCTATGAGAAATGGTTCCATGGGAAATTTGTTGTATGA MQGTCARQSQARKEVETYEEDKDEHSDILCRACGENYASDEFWICCDIYEKWFHGKFVV
BLAST of MELO3C033030.2 vs. NCBI nr
Match: XP_016903323.1 (PREDICTED: PHD finger protein ALFIN-LIKE 3-like [Cucumis melo]) HSP 1 Score: 132.1 bits (331), Expect = 6.2e-28 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MELO3C033030.2 vs. NCBI nr
Match: XP_004141692.1 (PREDICTED: PHD finger protein ALFIN-LIKE 3-like isoform X1 [Cucumis sativus] >KGN45504.1 hypothetical protein Csa_7G450620 [Cucumis sativus]) HSP 1 Score: 103.6 bits (257), Expect = 2.3e-19 Identity = 49/59 (83.05%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of MELO3C033030.2 vs. NCBI nr
Match: XP_008462330.1 (PREDICTED: PHD finger protein ALFIN-LIKE 3-like isoform X1 [Cucumis melo]) HSP 1 Score: 101.3 bits (251), Expect = 1.2e-18 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MELO3C033030.2 vs. NCBI nr
Match: XP_008462331.1 (PREDICTED: PHD finger protein ALFIN-LIKE 3-like isoform X2 [Cucumis melo]) HSP 1 Score: 101.3 bits (251), Expect = 1.2e-18 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MELO3C033030.2 vs. NCBI nr
Match: XP_022992372.1 (PHD finger protein ALFIN-LIKE 3-like [Cucurbita maxima]) HSP 1 Score: 96.7 bits (239), Expect = 2.9e-17 Identity = 45/59 (76.27%), Postives = 48/59 (81.36%), Query Frame = 0
BLAST of MELO3C033030.2 vs. TAIR10
Match: AT5G05610.1 (alfin-like 1) HSP 1 Score: 73.6 bits (179), Expect = 4.7e-14 Identity = 27/43 (62.79%), Postives = 35/43 (81.40%), Query Frame = 0
BLAST of MELO3C033030.2 vs. TAIR10
Match: AT5G20510.1 (alfin-like 5) HSP 1 Score: 63.5 bits (153), Expect = 4.9e-11 Identity = 24/32 (75.00%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of MELO3C033030.2 vs. TAIR10
Match: AT2G02470.1 (alfin-like 6) HSP 1 Score: 60.1 bits (144), Expect = 5.4e-10 Identity = 22/30 (73.33%), Postives = 25/30 (83.33%), Query Frame = 0
BLAST of MELO3C033030.2 vs. TAIR10
Match: AT1G14510.1 (alfin-like 7) HSP 1 Score: 59.7 bits (143), Expect = 7.0e-10 Identity = 22/30 (73.33%), Postives = 24/30 (80.00%), Query Frame = 0
BLAST of MELO3C033030.2 vs. TAIR10
Match: AT5G26210.1 (alfin-like 4) HSP 1 Score: 59.3 bits (142), Expect = 9.2e-10 Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 0
BLAST of MELO3C033030.2 vs. Swiss-Prot
Match: sp|Q9FFF5|ALFL1_ARATH (PHD finger protein ALFIN-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=AL1 PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 8.5e-13 Identity = 27/43 (62.79%), Postives = 35/43 (81.40%), Query Frame = 0
BLAST of MELO3C033030.2 vs. Swiss-Prot
Match: sp|A2Y0Q2|ALFL1_ORYSI (PHD finger protein ALFIN-LIKE 1 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_18576 PE=3 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 6.7e-10 Identity = 25/51 (49.02%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of MELO3C033030.2 vs. Swiss-Prot
Match: sp|Q75IR6|ALFL1_ORYSJ (PHD finger protein ALFIN-LIKE 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0163100 PE=2 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 6.7e-10 Identity = 25/51 (49.02%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of MELO3C033030.2 vs. Swiss-Prot
Match: sp|Q5XEM9|ALFL5_ARATH (PHD finger protein ALFIN-LIKE 5 OS=Arabidopsis thaliana OX=3702 GN=AL5 PE=2 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 8.8e-10 Identity = 24/32 (75.00%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of MELO3C033030.2 vs. Swiss-Prot
Match: sp|B8B8C5|ALFL9_ORYSI (PHD finger protein ALFIN-LIKE 9 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_26819 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.5e-09 Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = 0
BLAST of MELO3C033030.2 vs. TrEMBL
Match: tr|A0A1S4E514|A0A1S4E514_CUCME (PHD finger protein ALFIN-LIKE 3-like OS=Cucumis melo OX=3656 GN=LOC107992128 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 4.1e-28 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MELO3C033030.2 vs. TrEMBL
Match: tr|A0A0A0K9L1|A0A0A0K9L1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G450620 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.5e-19 Identity = 49/59 (83.05%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of MELO3C033030.2 vs. TrEMBL
Match: tr|A0A1S3CI87|A0A1S3CI87_CUCME (PHD finger protein ALFIN-LIKE 3-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103500707 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 7.7e-19 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MELO3C033030.2 vs. TrEMBL
Match: tr|A0A1S3CGR0|A0A1S3CGR0_CUCME (PHD finger protein ALFIN-LIKE 3-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103500707 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 7.7e-19 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MELO3C033030.2 vs. TrEMBL
Match: tr|A0A2P6Q1H7|A0A2P6Q1H7_ROSCH (Putative chromatin regulator PHD family OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr6g0311511 PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 4.4e-14 Identity = 39/59 (66.10%), Postives = 46/59 (77.97%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|