MELO3C033008.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.AAGAGGATCATAACCAGCCACAAGAGCTCTCCAAGCTTTTCCATCTAACGAAGAAGAGCTGCTGATTAGTGTGAAATACATTTATATATATACAAAATTAGGGGATGTTGTGGCAGCTTTGAAGATGACGGCTGATATAAAAAATTCTATCTAGTGAATGCATATATTTTGTGTTTGTTTCCATTTAATTTGGAATGTTACCTCAACCTTTCATAATTTCGTGTTTATGTATTGCACATGCCTTACTTGGTTGGTATATGTTGTGAGAATGAAGTTTCTTGTGGCAGGACATGGAGTAGCAAATGGTAGGTCTAAGCAAAGTAGAAGTGAGAAAAAGAGTCGTAAAGCAATGCTGAAGCTTGGAATGAAGCCTATCTCCGGTGTGAGCCATGTCACAGTCAAGAAGAGCAAAAATGTTGGTTTTTTTCAACATCCCAAATTTGACACTTCTAAATTGATTCTATCTAATATCAATGGCATTTTCTCTGCAGATGTTATCTAA AAGAGGATCATAACCAGCCACAAGAGCTCTCCAAGCTTTTCCATCTAACGAAGAAGAGCTGCTGATTAGTGTGAAATACATTTATATATATACAAAATTAGGGGATGTTGTGGCAGCTTTGAAGATGACGGCTGATATAAAAAATTCTATCTAGTGAATGCATATATTTTGTGTTTGTTTCCATTTAATTTGGAATGTTACCTCAACCTTTCATAATTTCGTGTTTATGTATTGCACATGCCTTACTTGGTTGGTATATGTTGTGAGAATGAAGTTTCTTGTGGCAGGACATGGAGTAGCAAATGGTAGGTCTAAGCAAAGTAGAAGTGAGAAAAAGAGTCGTAAAGCAATGCTGAAGCTTGGAATGAAGCCTATCTCCGGTGTGAGCCATGTCACAGTCAAGAAGAGCAAAAATGTTGGTTTTTTTCAACATCCCAAATTTGACACTTCTAAATTGATTCTATCTAATATCAATGGCATTTTCTCTGCAGATGTTATCTAA ATGCATATATTTTGTGTTTGTTTCCATTTAATTTGGAATGTTACCTCAACCTTTCATAATTTCGTGTTTATGTATTGCACATGCCTTACTTGGTTGGTATATGTTGTGAGAATGAAGTTTCTTGTGGCAGGACATGGAGTAGCAAATGGTAGGTCTAAGCAAAGTAGAAGTGAGAAAAAGAGTCGTAAAGCAATGCTGAAGCTTGGAATGAAGCCTATCTCCGGTGTGAGCCATGTCACAGTCAAGAAGAGCAAAAATGTTGGTTTTTTTCAACATCCCAAATTTGACACTTCTAAATTGATTCTATCTAATATCAATGGCATTTTCTCTGCAGATGTTATCTAA MHIFCVCFHLIWNVTSTFHNFVFMYCTCLTWLVYVVRMKFLVAGHGVANGRSKQSRSEKKSRKAMLKLGMKPISGVSHVTVKKSKNVGFFQHPKFDTSKLILSNINGIFSADVI
BLAST of MELO3C033008.2 vs. NCBI nr
Match: KGN54670.1 (Nascent polypeptide associated complex alpha [Cucumis sativus]) HSP 1 Score: 140.6 bits (353), Expect = 3.3e-30 Identity = 74/104 (71.15%), Postives = 83/104 (79.81%), Query Frame = 0
BLAST of MELO3C033008.2 vs. NCBI nr
Match: PWA77858.1 (UBA domain-containing protein/NAC domain-containing protein [Artemisia annua]) HSP 1 Score: 78.6 bits (192), Expect = 1.6e-11 Identity = 43/66 (65.15%), Postives = 49/66 (74.24%), Query Frame = 0
BLAST of MELO3C033008.2 vs. NCBI nr
Match: PQQ16729.1 (nascent polypeptide-associated complex subunit alpha-like protein 1 [Prunus yedoensis var. nudiflora]) HSP 1 Score: 77.8 bits (190), Expect = 2.7e-11 Identity = 44/63 (69.84%), Postives = 48/63 (76.19%), Query Frame = 0
BLAST of MELO3C033008.2 vs. NCBI nr
Match: XP_019435500.1 (PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 1 [Lupinus angustifolius] >OIV90030.1 hypothetical protein TanjilG_23950 [Lupinus angustifolius]) HSP 1 Score: 77.0 bits (188), Expect = 4.5e-11 Identity = 42/63 (66.67%), Postives = 49/63 (77.78%), Query Frame = 0
BLAST of MELO3C033008.2 vs. NCBI nr
Match: OIW22077.1 (hypothetical protein TanjilG_07140 [Lupinus angustifolius]) HSP 1 Score: 77.0 bits (188), Expect = 4.5e-11 Identity = 42/63 (66.67%), Postives = 49/63 (77.78%), Query Frame = 0
BLAST of MELO3C033008.2 vs. TAIR10
Match: AT3G12390.1 (Nascent polypeptide-associated complex (NAC), alpha subunit family protein) HSP 1 Score: 51.6 bits (122), Expect = 3.7e-07 Identity = 29/44 (65.91%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of MELO3C033008.2 vs. TAIR10
Match: AT5G13850.1 (nascent polypeptide-associated complex subunit alpha-like protein 3) HSP 1 Score: 48.5 bits (114), Expect = 3.1e-06 Identity = 27/42 (64.29%), Postives = 30/42 (71.43%), Query Frame = 0
BLAST of MELO3C033008.2 vs. TAIR10
Match: AT3G49470.1 (nascent polypeptide-associated complex subunit alpha-like protein 2) HSP 1 Score: 46.6 bits (109), Expect = 1.2e-05 Identity = 21/28 (75.00%), Postives = 26/28 (92.86%), Query Frame = 0
BLAST of MELO3C033008.2 vs. TAIR10
Match: AT1G33040.1 (nascent polypeptide-associated complex subunit alpha-like protein 5) HSP 1 Score: 41.2 bits (95), Expect = 5.0e-04 Identity = 19/27 (70.37%), Postives = 24/27 (88.89%), Query Frame = 0
BLAST of MELO3C033008.2 vs. Swiss-Prot
Match: sp|Q94518|NACA_DROME (Nascent polypeptide-associated complex subunit alpha OS=Drosophila melanogaster OX=7227 GN=Nacalpha PE=1 SV=2) HSP 1 Score: 53.9 bits (128), Expect = 1.3e-06 Identity = 28/54 (51.85%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of MELO3C033008.2 vs. Swiss-Prot
Match: sp|O15069|NACAD_HUMAN (NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3) HSP 1 Score: 53.5 bits (127), Expect = 1.8e-06 Identity = 28/54 (51.85%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of MELO3C033008.2 vs. Swiss-Prot
Match: sp|Q5SWP3|NACAD_MOUSE (NAC-alpha domain-containing protein 1 OS=Mus musculus OX=10090 GN=Nacad PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.8e-06 Identity = 28/54 (51.85%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of MELO3C033008.2 vs. Swiss-Prot
Match: sp|E9PAV3|NACAM_HUMAN (Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 3.0e-06 Identity = 24/39 (61.54%), Postives = 35/39 (89.74%), Query Frame = 0
BLAST of MELO3C033008.2 vs. Swiss-Prot
Match: sp|Q5E9A1|NACA_BOVIN (Nascent polypeptide-associated complex subunit alpha OS=Bos taurus OX=9913 GN=NACA PE=1 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 3.0e-06 Identity = 24/39 (61.54%), Postives = 35/39 (89.74%), Query Frame = 0
BLAST of MELO3C033008.2 vs. TrEMBL
Match: tr|A0A0A0KYD5|A0A0A0KYD5_CUCSA (Nascent polypeptide associated complex alpha OS=Cucumis sativus OX=3659 GN=Csa_4G420110 PE=4 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 2.2e-30 Identity = 74/104 (71.15%), Postives = 83/104 (79.81%), Query Frame = 0
BLAST of MELO3C033008.2 vs. TrEMBL
Match: tr|A0A2U1NWJ2|A0A2U1NWJ2_ARTAN (UBA domain-containing protein/NAC domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA219980 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 1.0e-11 Identity = 43/66 (65.15%), Postives = 49/66 (74.24%), Query Frame = 0
BLAST of MELO3C033008.2 vs. TrEMBL
Match: tr|A0A1J7FQ17|A0A1J7FQ17_LUPAN (Uncharacterized protein OS=Lupinus angustifolius OX=3871 GN=TanjilG_23950 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 3.0e-11 Identity = 42/63 (66.67%), Postives = 49/63 (77.78%), Query Frame = 0
BLAST of MELO3C033008.2 vs. TrEMBL
Match: tr|A0A2H5MZQ1|A0A2H5MZQ1_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_007270 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 3.9e-11 Identity = 44/65 (67.69%), Postives = 48/65 (73.85%), Query Frame = 0
BLAST of MELO3C033008.2 vs. TrEMBL
Match: tr|A0A1J7FPU0|A0A1J7FPU0_LUPAN (Uncharacterized protein OS=Lupinus angustifolius OX=3871 GN=TanjilG_23949 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 3.9e-11 Identity = 43/65 (66.15%), Postives = 48/65 (73.85%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|