MELO3C032552.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AAATGGAAGCAAATGAAGAAAGTATTAAGAACAAAGAGAAAGTGAAAAGCTTACTTCTTCTACTGCAGGCAGCATATGAAGAAAGAGATGAAGCAAGAGATCAACTGCAGAAACTGATGAACAAGATTATGCCAACTTCAATTAACTTCATCGACCATCATGCTAATCAATCTCAACTTCAATTTTTTTTCCACACAGAAGAAAAATATGACAAGAAACAATG AAATGGAAGCAAATGAAGAAAGTATTAAGAACAAAGAGAAAGTGAAAAGCTTACTTCTTCTACTGCAGGCAGCATATGAAGAAAGAGATGAAGCAAGAGATCAACTGCAGAAACTGATGAACAAGATTATGCCAACTTCAATTAACTTCATCGACCATCATGCTAATCAATCTCAACTTCAATTTTTTTTCCACACAGAAGAAAAATATGACAAGAAACAATG ATGGAAGCAAATGAAGAAAGTATTAAGAACAAAGAGAAAGTGAAAAGCTTACTTCTTCTACTGCAGGCAGCATATGAAGAAAGAGATGAAGCAAGAGATCAACTGCAGAAACTGATGAACAAGATTATGCCAACTTCAATTAACTTCATCGACCATCATGCTAATCAATCTCAACTTCAATTTTTTTTCCACACAGAAGAAAAATATGACAAGAAACAA MEANEESIKNKEKVKSLLLLLQAAYEERDEARDQLQKLMNKIMPTSINFIDHHANQSQLQFFFHTEEKYDKKQ
BLAST of MELO3C032552.2 vs. NCBI nr
Match: XP_011657251.1 (PREDICTED: uncharacterized protein LOC101217302 [Cucumis sativus] >KGN47356.1 hypothetical protein Csa_6G303220 [Cucumis sativus]) HSP 1 Score: 85.9 bits (211), Expect = 6.3e-14 Identity = 44/46 (95.65%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MELO3C032552.2 vs. NCBI nr
Match: XP_022148299.1 (uncharacterized protein LOC111016987 [Momordica charantia]) HSP 1 Score: 84.7 bits (208), Expect = 1.4e-13 Identity = 44/46 (95.65%), Postives = 45/46 (97.83%), Query Frame = 0
BLAST of MELO3C032552.2 vs. NCBI nr
Match: XP_022943940.1 (uncharacterized protein LOC111448511 [Cucurbita moschata]) HSP 1 Score: 84.7 bits (208), Expect = 1.4e-13 Identity = 44/46 (95.65%), Postives = 45/46 (97.83%), Query Frame = 0
BLAST of MELO3C032552.2 vs. NCBI nr
Match: XP_022986908.1 (uncharacterized protein LOC111484506 [Cucurbita maxima]) HSP 1 Score: 84.7 bits (208), Expect = 1.4e-13 Identity = 44/46 (95.65%), Postives = 45/46 (97.83%), Query Frame = 0
BLAST of MELO3C032552.2 vs. NCBI nr
Match: XP_023511993.1 (uncharacterized protein LOC111776837 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 84.7 bits (208), Expect = 1.4e-13 Identity = 44/46 (95.65%), Postives = 45/46 (97.83%), Query Frame = 0
BLAST of MELO3C032552.2 vs. TAIR10
Match: AT2G28690.1 (Protein of unknown function (DUF1635)) HSP 1 Score: 47.0 bits (110), Expect = 5.8e-06 Identity = 28/61 (45.90%), Postives = 41/61 (67.21%), Query Frame = 0
BLAST of MELO3C032552.2 vs. TrEMBL
Match: tr|A0A0A0KHV7|A0A0A0KHV7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G303220 PE=4 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 4.1e-14 Identity = 44/46 (95.65%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MELO3C032552.2 vs. TrEMBL
Match: tr|A0A1S3BKE0|A0A1S3BKE0_CUCME (Uncharacterized protein OS=Cucumis melo OX=3656 GN=LOC103490578 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.2e-13 Identity = 44/46 (95.65%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MELO3C032552.2 vs. TrEMBL
Match: tr|A0A2I4EMN7|A0A2I4EMN7_9ROSI (uncharacterized protein LOC108990971 isoform X1 OS=Juglans regia OX=51240 GN=LOC108990971 PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 5.8e-08 Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C032552.2 vs. TrEMBL
Match: tr|A0A2I4EMN8|A0A2I4EMN8_9ROSI (uncharacterized protein LOC108990971 isoform X2 OS=Juglans regia OX=51240 GN=LOC108990971 PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 5.8e-08 Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C032552.2 vs. TrEMBL
Match: tr|A0A2R6PFE9|A0A2R6PFE9_ACTCH (Centromere protein like OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc30226 PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 2.4e-06 Identity = 31/44 (70.45%), Postives = 37/44 (84.09%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |