MELO3C032391.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TGGCGACAGAGGGAATTCGTCGACAACGGACAGGGAATTGGTGACACTTTGTTCGGAGTTTTTGAACGGCGGAACGGACACGACGGAGACAGTGATAGAGTGGGGAATGGTGGAATTGGTAGCGAATGAGGAAGTTCAAAGGAATATTATGGAAGAAATTAAAGAAACGGTTGGTGAGAGAAAAATAGA TGGCGACAGAGGGAATTCGTCGACAACGGACAGGGAATTGGTGACACTTTGTTCGGAGTTTTTGAACGGCGGAACGGACACGACGGAGACAGTGATAGAGTGGGGAATGGTGGAATTGGTAGCGAATGAGGAAGTTCAAAGGAATATTATGGAAGAAATTAAAGAAACGGTTGGTGAGAGAAAAATAGA GGCGACAGAGGGAATTCGTCGACAACGGACAGGGAATTGGTGACACTTTGTTCGGAGTTTTTGAACGGCGGAACGGACACGACGGAGACAGTGATAGAGTGGGGAATGGTGGAATTGGTAGCGAATGAGGAAGTTCAAAGGAATATTATGGAAGAAATTAAAGAAACGGTTGGTGAGAGAAAAATA GDRGNSSTTDRELVTLCSEFLNGGTDTTETVIEWGMVELVANEEVQRNIMEEIKETVGERKI
BLAST of MELO3C032391.2 vs. NCBI nr
Match: XP_008446777.2 (PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Cucumis melo]) HSP 1 Score: 101.7 bits (252), Expect = 9.4e-19 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of MELO3C032391.2 vs. NCBI nr
Match: XP_011655840.1 (PREDICTED: cytochrome P450 77A3-like [Cucumis sativus] >KGN52206.1 hypothetical protein Csa_5G615280 [Cucumis sativus]) HSP 1 Score: 100.5 bits (249), Expect = 2.1e-18 Identity = 49/62 (79.03%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C032391.2 vs. NCBI nr
Match: XP_022957595.1 (cytochrome P450 77A3-like [Cucurbita moschata]) HSP 1 Score: 85.9 bits (211), Expect = 5.3e-14 Identity = 40/59 (67.80%), Postives = 48/59 (81.36%), Query Frame = 0
BLAST of MELO3C032391.2 vs. NCBI nr
Match: XP_022984653.1 (cytochrome P450 77A3-like [Cucurbita maxima]) HSP 1 Score: 85.9 bits (211), Expect = 5.3e-14 Identity = 40/59 (67.80%), Postives = 48/59 (81.36%), Query Frame = 0
BLAST of MELO3C032391.2 vs. NCBI nr
Match: XP_023546857.1 (cytochrome P450 77A3-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 85.9 bits (211), Expect = 5.3e-14 Identity = 40/59 (67.80%), Postives = 48/59 (81.36%), Query Frame = 0
BLAST of MELO3C032391.2 vs. TAIR10
Match: AT3G10560.1 (Cytochrome P450 superfamily protein) HSP 1 Score: 73.2 bits (178), Expect = 6.5e-14 Identity = 33/57 (57.89%), Postives = 44/57 (77.19%), Query Frame = 0
BLAST of MELO3C032391.2 vs. TAIR10
Match: AT3G10570.1 (cytochrome P450, family 77, subfamily A, polypeptide 6) HSP 1 Score: 73.2 bits (178), Expect = 6.5e-14 Identity = 32/57 (56.14%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of MELO3C032391.2 vs. TAIR10
Match: AT5G04660.1 (cytochrome P450, family 77, subfamily A, polypeptide 4) HSP 1 Score: 72.8 bits (177), Expect = 8.4e-14 Identity = 33/54 (61.11%), Postives = 44/54 (81.48%), Query Frame = 0
BLAST of MELO3C032391.2 vs. TAIR10
Match: AT5G04630.1 (cytochrome P450, family 77, subfamily A, polypeptide 9) HSP 1 Score: 71.2 bits (173), Expect = 2.5e-13 Identity = 33/58 (56.90%), Postives = 44/58 (75.86%), Query Frame = 0
BLAST of MELO3C032391.2 vs. TAIR10
Match: AT2G12190.1 (Cytochrome P450 superfamily protein) HSP 1 Score: 65.9 bits (159), Expect = 1.0e-11 Identity = 30/48 (62.50%), Postives = 37/48 (77.08%), Query Frame = 0
BLAST of MELO3C032391.2 vs. Swiss-Prot
Match: sp|O48928|C77A3_SOYBN (Cytochrome P450 77A3 OS=Glycine max OX=3847 GN=CYP77A3 PE=2 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 2.8e-14 Identity = 36/57 (63.16%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of MELO3C032391.2 vs. Swiss-Prot
Match: sp|P37124|C77A2_SOLME (Cytochrome P450 77A2 OS=Solanum melongena OX=4111 GN=CYP77A2 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 8.9e-13 Identity = 37/58 (63.79%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C032391.2 vs. Swiss-Prot
Match: sp|Q9LZ31|C77A4_ARATH (Cytochrome P450 77A4 OS=Arabidopsis thaliana OX=3702 GN=CYP77A4 PE=2 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.5e-12 Identity = 33/54 (61.11%), Postives = 44/54 (81.48%), Query Frame = 0
BLAST of MELO3C032391.2 vs. Swiss-Prot
Match: sp|P37123|C77A1_SOLME (Cytochrome P450 77A1 (Fragment) OS=Solanum melongena OX=4111 GN=CYP77A1 PE=2 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 2.2e-11 Identity = 32/57 (56.14%), Postives = 42/57 (73.68%), Query Frame = 0
BLAST of MELO3C032391.2 vs. Swiss-Prot
Match: sp|Q42602|C89A2_ARATH (Cytochrome P450 89A2 OS=Arabidopsis thaliana OX=3702 GN=CYP89A2 PE=2 SV=2) HSP 1 Score: 55.5 bits (132), Expect = 2.5e-07 Identity = 26/55 (47.27%), Postives = 34/55 (61.82%), Query Frame = 0
BLAST of MELO3C032391.2 vs. TrEMBL
Match: tr|A0A1S3BGP7|A0A1S3BGP7_CUCME (LOW QUALITY PROTEIN: cytochrome P450 77A3-like OS=Cucumis melo OX=3656 GN=LOC103489405 PE=3 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 6.2e-19 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of MELO3C032391.2 vs. TrEMBL
Match: tr|A0A0A0KWN5|A0A0A0KWN5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G615280 PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.4e-18 Identity = 49/62 (79.03%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C032391.2 vs. TrEMBL
Match: tr|A0A2I4HB86|A0A2I4HB86_9ROSI (cytochrome P450 77A3-like OS=Juglans regia OX=51240 GN=LOC109015403 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.3e-13 Identity = 40/57 (70.18%), Postives = 47/57 (82.46%), Query Frame = 0
BLAST of MELO3C032391.2 vs. TrEMBL
Match: tr|A0A2C9VLD9|A0A2C9VLD9_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_07G091600 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.1e-12 Identity = 38/57 (66.67%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of MELO3C032391.2 vs. TrEMBL
Match: tr|A0A0L9TZ26|A0A0L9TZ26_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan02g180200 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.5e-12 Identity = 38/61 (62.30%), Postives = 48/61 (78.69%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|