MELO3C031946.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTAAAATAGTCTATAATACGAGAATACTGTATCAATTGCTCATTGTGTGTCATGTCATCACAAGCTTTTAATATTGATCAAAGTGTTGAGTATACCTAACATTTAGGTAGAGCAATAATTAATTTGTATGTTTAAAAAAATGCAGCATTCAACTACACCCCATCAACACACAATGTGGTAGAAGTTGACAAAGTGGGTTACAATTGGTGTTTGATTAATCCAATAGAAGCAACTGTTCATCATTCAGGAAAGGATCAAATGAAGCTTGTTGAGGGCATGAATTATTATATCTGCAGCCTTCCTGGCCATTGTCAAATGGGAATGAAACTTGCTATTAATGCTACTTCTTCATCATAAAATATATCATATTAATAATCTTCAAATGAGTTATATCTATATATATATAAACAAAGATACTTCATATATTTAACTTATACTTTATATCTAAGTTATGAGTTTGATGTGCCA ATGACATTCAACTACACCCCATCAACACACAATGTGGTAGAAGTTGACAAAGTGGGTTACAATTGGTGTTTGATTAATCCAATAGAAGCAACTGTTCATCATTCAGGAAAGGATCAAATGAAGCTTGTTGAGGGCATGAATTATTATATCTGCAGCCTTCCTGGCCATTGTCAAATGGGAATGAAACTTGCTATTAATGCTACTTCTTCATCATAAAATATATCATATTAATAATCTTCAAATGAGTTATATCTATATATATATAAACAAAGATACTTCATATATTTAACTTATACTTTATATCTAAGTTATGAGTTTGATGTGCCA ATGACATTCAACTACACCCCATCAACACACAATGTGGTAGAAGTTGACAAAGTGGGTTACAATTGGTGTTTGATTAATCCAATAGAAGCAACTGTTCATCATTCAGGAAAGGATCAAATGAAGCTTGTTGAGGGCATGAATTATTATATCTGCAGCCTTCCTGGCCATTGTCAAATGGGAATGAAACTTGCTATTAATGCTACTTCTTCATCATAA MTFNYTPSTHNVVEVDKVGYNWCLINPIEATVHHSGKDQMKLVEGMNYYICSLPGHCQMGMKLAINATSSS
BLAST of MELO3C031946.2 vs. NCBI nr
Match: XP_008456091.1 (PREDICTED: basic blue protein-like [Cucumis melo]) HSP 1 Score: 153.3 bits (386), Expect = 3.1e-34 Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MELO3C031946.2 vs. NCBI nr
Match: XP_004149974.1 (PREDICTED: basic blue protein-like [Cucumis sativus] >KGN57570.1 hypothetical protein Csa_3G214590 [Cucumis sativus]) HSP 1 Score: 131.0 bits (328), Expect = 1.6e-27 Identity = 58/69 (84.06%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of MELO3C031946.2 vs. NCBI nr
Match: XP_022942770.1 (basic blue protein-like [Cucurbita moschata]) HSP 1 Score: 125.9 bits (315), Expect = 5.3e-26 Identity = 54/67 (80.60%), Postives = 61/67 (91.04%), Query Frame = 0
BLAST of MELO3C031946.2 vs. NCBI nr
Match: XP_022983401.1 (basic blue protein-like [Cucurbita maxima]) HSP 1 Score: 125.9 bits (315), Expect = 5.3e-26 Identity = 54/67 (80.60%), Postives = 61/67 (91.04%), Query Frame = 0
BLAST of MELO3C031946.2 vs. NCBI nr
Match: XP_023514733.1 (basic blue protein-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 123.2 bits (308), Expect = 3.4e-25 Identity = 52/67 (77.61%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of MELO3C031946.2 vs. TAIR10
Match: AT2G02850.1 (plantacyanin) HSP 1 Score: 71.6 bits (174), Expect = 2.2e-13 Identity = 31/67 (46.27%), Postives = 43/67 (64.18%), Query Frame = 0
BLAST of MELO3C031946.2 vs. TAIR10
Match: AT2G32300.1 (uclacyanin 1) HSP 1 Score: 50.8 bits (120), Expect = 3.9e-07 Identity = 25/73 (34.25%), Postives = 40/73 (54.79%), Query Frame = 0
BLAST of MELO3C031946.2 vs. TAIR10
Match: AT2G31050.1 (Cupredoxin superfamily protein) HSP 1 Score: 48.1 bits (113), Expect = 2.5e-06 Identity = 25/72 (34.72%), Postives = 37/72 (51.39%), Query Frame = 0
BLAST of MELO3C031946.2 vs. TAIR10
Match: AT1G22480.1 (Cupredoxin superfamily protein) HSP 1 Score: 47.4 bits (111), Expect = 4.3e-06 Identity = 27/70 (38.57%), Postives = 35/70 (50.00%), Query Frame = 0
BLAST of MELO3C031946.2 vs. TAIR10
Match: AT2G26720.1 (Cupredoxin superfamily protein) HSP 1 Score: 45.8 bits (107), Expect = 1.3e-05 Identity = 23/73 (31.51%), Postives = 38/73 (52.05%), Query Frame = 0
BLAST of MELO3C031946.2 vs. Swiss-Prot
Match: sp|P00303|BABL_CUCSA (Basic blue protein OS=Cucumis sativus OX=3659 PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 6.4e-15 Identity = 35/67 (52.24%), Postives = 49/67 (73.13%), Query Frame = 0
BLAST of MELO3C031946.2 vs. Swiss-Prot
Match: sp|P60496|BABL_LILLO (Chemocyanin OS=Lilium longiflorum OX=4690 PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.7e-12 Identity = 32/67 (47.76%), Postives = 43/67 (64.18%), Query Frame = 0
BLAST of MELO3C031946.2 vs. Swiss-Prot
Match: sp|Q8LG89|BABL_ARATH (Basic blue protein OS=Arabidopsis thaliana OX=3702 GN=ARPN PE=2 SV=2) HSP 1 Score: 71.6 bits (174), Expect = 3.9e-12 Identity = 31/67 (46.27%), Postives = 43/67 (64.18%), Query Frame = 0
BLAST of MELO3C031946.2 vs. Swiss-Prot
Match: sp|P80728|MAVI_CUCPE (Mavicyanin OS=Cucurbita pepo OX=3663 PE=1 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 1.9e-06 Identity = 26/72 (36.11%), Postives = 39/72 (54.17%), Query Frame = 0
BLAST of MELO3C031946.2 vs. Swiss-Prot
Match: sp|O82081|UCC1_ARATH (Uclacyanin 1 OS=Arabidopsis thaliana OX=3702 GN=UCC1 PE=1 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 7.1e-06 Identity = 25/73 (34.25%), Postives = 40/73 (54.79%), Query Frame = 0
BLAST of MELO3C031946.2 vs. TrEMBL
Match: tr|A0A1S3C342|A0A1S3C342_CUCME (basic blue protein-like OS=Cucumis melo OX=3656 GN=LOC103496130 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 2.1e-34 Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MELO3C031946.2 vs. TrEMBL
Match: tr|A0A0A0L6J3|A0A0A0L6J3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G214590 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 1.1e-27 Identity = 58/69 (84.06%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of MELO3C031946.2 vs. TrEMBL
Match: tr|D7T037|D7T037_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_12s0034g01140 PE=4 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 3.3e-16 Identity = 39/68 (57.35%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of MELO3C031946.2 vs. TrEMBL
Match: tr|F6H924|F6H924_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_12s0034g01150 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 9.6e-16 Identity = 38/67 (56.72%), Postives = 51/67 (76.12%), Query Frame = 0
BLAST of MELO3C031946.2 vs. TrEMBL
Match: tr|A0A1S3CPL7|A0A1S3CPL7_CUCME (basic blue protein-like OS=Cucumis melo OX=3656 GN=LOC103503230 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 2.1e-15 Identity = 39/67 (58.21%), Postives = 53/67 (79.10%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|