MELO3C031742.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCACTGTACTGCCTGATTCAGTTCTATACAGTTACAAGGATGAATTGGTACATATAAAGCCATTGGCCAAATTTTTTATGTTTAAATCTATAGTATTTTTGACTTGGTGGCAAGGTGTTGGAATTATATTGCTCTCCTATCCAGTTTGTGTACTTTTTTTCCATCTCAAGGAATATCGAAACGTCACATAAAATTTCCATTAGCTCCTCAT ATGGGCACTGTACTGCCTGATTCAGTTCTATACAGTTACAAGGATGAATTGGTACATATAAAGCCATTGGCCAAATTTTTTATGTTTAAATCTATAGTATTTTTGACTTGGTGGCAAGGTGTTGGAATTATATTGCTCTCCTATCCAGTTTGTGTACTTTTTTTCCATCTCAAGGAATATCGAAACGTCACATAAAATTTCCATTAGCTCCTCAT ATGGGCACTGTACTGCCTGATTCAGTTCTATACAGTTACAAGGATGAATTGGTACATATAAAGCCATTGGCCAAATTTTTTATGTTTAAATCTATAGTATTTTTGACTTGGTGGCAAGGTGTTGGAATTATATTGCTCTCCTATCCAGTTTGTGTACTTTTTTTCCATCTCAAGGAATATCGAAACGTCACATAA MGTVLPDSVLYSYKDELVHIKPLAKFFMFKSIVFLTWWQGVGIILLSYPVCVLFFHLKEYRNVT
BLAST of MELO3C031742.2 vs. NCBI nr
Match: XP_004144883.1 (PREDICTED: transmembrane protein 184C isoform X1 [Cucumis sativus] >XP_011658627.1 PREDICTED: transmembrane protein 184C isoform X1 [Cucumis sativus] >KGN43330.1 hypothetical protein Csa_7G024040 [Cucumis sativus]) HSP 1 Score: 68.2 bits (165), Expect = 1.2e-08 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MELO3C031742.2 vs. NCBI nr
Match: XP_008447853.1 (PREDICTED: protein LAZ1 isoform X1 [Cucumis melo] >XP_008447854.1 PREDICTED: protein LAZ1 isoform X1 [Cucumis melo] >XP_008447855.1 PREDICTED: protein LAZ1 isoform X1 [Cucumis melo] >XP_008447856.1 PREDICTED: protein LAZ1 isoform X1 [Cucumis melo] >XP_016900495.1 PREDICTED: protein LAZ1 isoform X1 [Cucumis melo]) HSP 1 Score: 68.2 bits (165), Expect = 1.2e-08 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MELO3C031742.2 vs. NCBI nr
Match: XP_008447860.1 (PREDICTED: protein LAZ1 isoform X2 [Cucumis melo]) HSP 1 Score: 68.2 bits (165), Expect = 1.2e-08 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MELO3C031742.2 vs. NCBI nr
Match: XP_011658628.1 (PREDICTED: transmembrane protein 184C isoform X2 [Cucumis sativus]) HSP 1 Score: 68.2 bits (165), Expect = 1.2e-08 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MELO3C031742.2 vs. NCBI nr
Match: XP_011658629.1 (PREDICTED: transmembrane protein 184C isoform X3 [Cucumis sativus]) HSP 1 Score: 68.2 bits (165), Expect = 1.2e-08 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MELO3C031742.2 vs. TAIR10
Match: AT4G38360.2 (Protein of unknown function (DUF300)) HSP 1 Score: 60.5 bits (145), Expect = 4.5e-10 Identity = 28/34 (82.35%), Postives = 29/34 (85.29%), Query Frame = 0
BLAST of MELO3C031742.2 vs. TAIR10
Match: AT1G77220.1 (Protein of unknown function (DUF300)) HSP 1 Score: 50.8 bits (120), Expect = 3.5e-07 Identity = 23/33 (69.70%), Postives = 26/33 (78.79%), Query Frame = 0
BLAST of MELO3C031742.2 vs. TAIR10
Match: AT1G23070.1 (Protein of unknown function (DUF300)) HSP 1 Score: 50.4 bits (119), Expect = 4.6e-07 Identity = 23/34 (67.65%), Postives = 25/34 (73.53%), Query Frame = 0
BLAST of MELO3C031742.2 vs. Swiss-Prot
Match: sp|F4JTN2|LAZ1_ARATH (Protein LAZ1 OS=Arabidopsis thaliana OX=3702 GN=LAZ1 PE=1 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 8.1e-09 Identity = 28/34 (82.35%), Postives = 29/34 (85.29%), Query Frame = 0
BLAST of MELO3C031742.2 vs. Swiss-Prot
Match: sp|Q94CA0|LAZH1_ARATH (Protein LAZ1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=At1g77220 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 6.4e-06 Identity = 23/33 (69.70%), Postives = 26/33 (78.79%), Query Frame = 0
BLAST of MELO3C031742.2 vs. Swiss-Prot
Match: sp|Q5BPZ5|LAZH2_ARATH (Protein LAZ1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At1g23070 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 8.4e-06 Identity = 23/34 (67.65%), Postives = 25/34 (73.53%), Query Frame = 0
BLAST of MELO3C031742.2 vs. TrEMBL
Match: tr|A0A1S3BJA8|A0A1S3BJA8_CUCME (protein LAZ1 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103490216 PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 7.8e-09 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MELO3C031742.2 vs. TrEMBL
Match: tr|A0A1S3BJ10|A0A1S3BJ10_CUCME (protein LAZ1 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103490216 PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 7.8e-09 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MELO3C031742.2 vs. TrEMBL
Match: tr|A0A0A0K0U8|A0A0A0K0U8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G024040 PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 7.8e-09 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MELO3C031742.2 vs. TrEMBL
Match: tr|A0A2I0BHC1|A0A2I0BHC1_9ASPA (Uncharacterized protein OS=Apostasia shenzhenica OX=1088818 GN=AXF42_Ash004688 PE=4 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.9e-08 Identity = 33/47 (70.21%), Postives = 35/47 (74.47%), Query Frame = 0
BLAST of MELO3C031742.2 vs. TrEMBL
Match: tr|A0A200QZV9|A0A200QZV9_9MAGN (Organic solute transporter Ost-alpha OS=Macleaya cordata OX=56857 GN=BVC80_1823g64 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 3.3e-07 Identity = 29/34 (85.29%), Postives = 30/34 (88.24%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|