MELO3C031721.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTAAGCGTTTAATTGCTCGAAAATTTAGCGATCCATCGGTCTAGAGTGATATCAAGCTCTGGCCGTTTAAAGTTATTGTCGGTCTTAGCGATAAGCCAATGATTGTTGTAAACTACAAGGGTGAAGAGAAGCAGTTCTCTGCTGAAGAAATCTCTTCTATGGTGCTCATAAAGATGATTGCTGAGGCGTATCTCGGCACAACAGTGAAGAATGTTGTTGTCACTGTCTTGGCTTACTTCAACGATTCTCAGAGACAGGCCACCAAGGATGCTGGTGTCATTTTCGGCCTAAATGTGATGCGTATTATCAATGAACCAATAGCTGCCGCCATTGCTTATGGTCTTGACAAGAAGTTGAGCAGCTCTAACACAAATAATTGTTAA ATGCTAAGCGTTTAATTGCTCGAAAATTTAGCGATCCATCGGTCTAGAGTGATATCAAGCTCTGGCCGTTTAAAGTTATTGTCGGTCTTAGCGATAAGCCAATGATTGTTGTAAACTACAAGGGTGAAGAGAAGCAGTTCTCTGCTGAAGAAATCTCTTCTATGGTGCTCATAAAGATGATTGCTGAGGCGTATCTCGGCACAACAGTGAAGAATGTTGTTGTCACTGTCTTGGCTTACTTCAACGATTCTCAGAGACAGGCCACCAAGGATGCTGGTGTCATTTTCGGCCTAAATGTGATGCGTATTATCAATGAACCAATAGCTGCCGCCATTGCTTATGGTCTTGACAAGAAGTTGAGCAGCTCTAACACAAATAATTGTTAA ATGATTGTTGTAAACTACAAGGGTGAAGAGAAGCAGTTCTCTGCTGAAGAAATCTCTTCTATGGTGCTCATAAAGATGATTGCTGAGGCGTATCTCGGCACAACAGTGAAGAATGTTGTTGTCACTGTCTTGGCTTACTTCAACGATTCTCAGAGACAGGCCACCAAGGATGCTGGTGTCATTTTCGGCCTAAATGTGATGCGTATTATCAATGAACCAATAGCTGCCGCCATTGCTTATGGTCTTGACAAGAAGTTGAGCAGCTCTAACACAAATAATTGTTAA MIVVNYKGEEKQFSAEEISSMVLIKMIAEAYLGTTVKNVVVTVLAYFNDSQRQATKDAGVIFGLNVMRIINEPIAAAIAYGLDKKLSSSNTNNC
BLAST of MELO3C031721.2 vs. NCBI nr
Match: XP_016902212.1 (PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis melo] >XP_016902213.1 PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis melo] >XP_016902214.1 PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis melo]) HSP 1 Score: 159.5 bits (402), Expect = 5.7e-36 Identity = 86/96 (89.58%), Postives = 88/96 (91.67%), Query Frame = 0
BLAST of MELO3C031721.2 vs. NCBI nr
Match: NP_001295800.1 (heat shock cognate 70 kDa protein 2-like [Cucumis sativus] >CAB72129.1 heat shock protein 70 [Cucumis sativus]) HSP 1 Score: 152.5 bits (384), Expect = 7.0e-34 Identity = 85/95 (89.47%), Postives = 85/95 (89.47%), Query Frame = 0
BLAST of MELO3C031721.2 vs. NCBI nr
Match: KGN51286.1 (Heat shock protein 70 [Cucumis sativus]) HSP 1 Score: 152.5 bits (384), Expect = 7.0e-34 Identity = 85/95 (89.47%), Postives = 85/95 (89.47%), Query Frame = 0
BLAST of MELO3C031721.2 vs. NCBI nr
Match: XP_008458906.1 (PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis melo]) HSP 1 Score: 152.5 bits (384), Expect = 7.0e-34 Identity = 85/95 (89.47%), Postives = 85/95 (89.47%), Query Frame = 0
BLAST of MELO3C031721.2 vs. NCBI nr
Match: XP_022133761.1 (heat shock cognate 70 kDa protein 2-like [Momordica charantia]) HSP 1 Score: 151.8 bits (382), Expect = 1.2e-33 Identity = 84/95 (88.42%), Postives = 85/95 (89.47%), Query Frame = 0
BLAST of MELO3C031721.2 vs. TAIR10
Match: AT3G09440.1 (Heat shock protein 70 (Hsp 70) family protein) HSP 1 Score: 146.4 bits (368), Expect = 9.1e-36 Identity = 79/95 (83.16%), Postives = 84/95 (88.42%), Query Frame = 0
BLAST of MELO3C031721.2 vs. TAIR10
Match: AT3G12580.1 (heat shock protein 70) HSP 1 Score: 143.3 bits (360), Expect = 7.7e-35 Identity = 80/95 (84.21%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of MELO3C031721.2 vs. TAIR10
Match: AT5G02490.1 (Heat shock protein 70 (Hsp 70) family protein) HSP 1 Score: 143.3 bits (360), Expect = 7.7e-35 Identity = 79/95 (83.16%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of MELO3C031721.2 vs. TAIR10
Match: AT1G56410.1 (heat shock protein 70 (Hsp 70) family protein) HSP 1 Score: 141.7 bits (356), Expect = 2.2e-34 Identity = 77/95 (81.05%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of MELO3C031721.2 vs. TAIR10
Match: AT5G02500.1 (heat shock cognate protein 70-1) HSP 1 Score: 140.6 bits (353), Expect = 5.0e-34 Identity = 77/95 (81.05%), Postives = 81/95 (85.26%), Query Frame = 0
BLAST of MELO3C031721.2 vs. Swiss-Prot
Match: sp|P11143|HSP70_MAIZE (Heat shock 70 kDa protein OS=Zea mays OX=4577 GN=HSP70 PE=3 SV=2) HSP 1 Score: 146.7 bits (369), Expect = 1.3e-34 Identity = 80/95 (84.21%), Postives = 84/95 (88.42%), Query Frame = 0
BLAST of MELO3C031721.2 vs. Swiss-Prot
Match: sp|O65719|HSP7C_ARATH (Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana OX=3702 GN=HSP70-3 PE=1 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 1.6e-34 Identity = 79/95 (83.16%), Postives = 84/95 (88.42%), Query Frame = 0
BLAST of MELO3C031721.2 vs. Swiss-Prot
Match: sp|P09189|HSP7C_PETHY (Heat shock cognate 70 kDa protein OS=Petunia hybrida OX=4102 GN=HSP70 PE=2 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 2.1e-34 Identity = 80/95 (84.21%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of MELO3C031721.2 vs. Swiss-Prot
Match: sp|P27322|HSP72_SOLLC (Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum OX=4081 GN=HSC-2 PE=2 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 4.8e-34 Identity = 81/95 (85.26%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of MELO3C031721.2 vs. Swiss-Prot
Match: sp|Q9LHA8|MD37C_ARATH (Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana OX=3702 GN=MED37C PE=1 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 1.4e-33 Identity = 80/95 (84.21%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of MELO3C031721.2 vs. TrEMBL
Match: tr|A0A1S4E1V9|A0A1S4E1V9_CUCME (heat shock cognate 70 kDa protein-like OS=Cucumis melo OX=3656 GN=LOC103497606 PE=3 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 3.8e-36 Identity = 86/96 (89.58%), Postives = 88/96 (91.67%), Query Frame = 0
BLAST of MELO3C031721.2 vs. TrEMBL
Match: tr|A0A1S3C8Y7|A0A1S3C8Y7_CUCME (heat shock cognate 70 kDa protein 2-like OS=Cucumis melo OX=3656 GN=LOC103498170 PE=3 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 4.6e-34 Identity = 85/95 (89.47%), Postives = 85/95 (89.47%), Query Frame = 0
BLAST of MELO3C031721.2 vs. TrEMBL
Match: tr|A0A0A0KU74|A0A0A0KU74_CUCSA (Heat shock protein 70 OS=Cucumis sativus OX=3659 GN=Csa_5G512930 PE=3 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 4.6e-34 Identity = 85/95 (89.47%), Postives = 85/95 (89.47%), Query Frame = 0
BLAST of MELO3C031721.2 vs. TrEMBL
Match: tr|Q9M4E7|Q9M4E7_CUCSA (Heat shock protein 70 OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 4.6e-34 Identity = 85/95 (89.47%), Postives = 85/95 (89.47%), Query Frame = 0
BLAST of MELO3C031721.2 vs. TrEMBL
Match: tr|Q8GSN3|Q8GSN3_CUCMA (Non-cell-autonomous heat shock cognate protein 70 OS=Cucurbita maxima OX=3661 GN=Hsc70-1 PE=2 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 3.0e-33 Identity = 82/95 (86.32%), Postives = 85/95 (89.47%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|