MELO3C031720.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGACGCCGTTTTCGTACCTGGACACGCTTTCGATTTTAAAATCGACGGGCGTGGTGGCGGAGGGAATTCGTCGACGACGGACAGGATATTGGTGACACTTTATTCGGAGTTTTTGAACGGTGAGCCGGACACGACGGAGACAGTGATAGAGTGGGGGATTGCGGAATTGATAGCGAATGAGGAAGTTCAGAGGAAGATTGTGGAAGAAATTAAAGAAACGGTTGGTGAGAGA ATGCGACGCCGTTTTCGTACCTGGACACGCTTTCGATTTTAAAATCGACGGGCGTGGTGGCGGAGGGAATTCGTCGACGACGGACAGGATATTGGTGACACTTTATTCGGAGTTTTTGAACGGTGAGCCGGACACGACGGAGACAGTGATAGAGTGGGGGATTGCGGAATTGATAGCGAATGAGGAAGTTCAGAGGAAGATTGTGGAAGAAATTAAAGAAACGGTTGGTGAGAGA TGCGACGCCGTTTTCGTACCTGGACACGCTTTCGATTTTAAAATCGACGGGCGTGGTGGCGGAGGGAATTCGTCGACGACGGACAGGATATTGGTGACACTTTATTCGGAGTTTTTGAACGGTGAGCCGGACACGACGGAGACAGTGATAGAGTGGGGGATTGCGGAATTGATAGCGAATGAGGAAGTTCAGAGGAAGATTGTGGAAGAAATTAAAGAAACGGTTGGTGAGAGA CDAVFVPGHAFDFKIDGRGGGGNSSTTDRILVTLYSEFLNGEPDTTETVIEWGIAELIANEEVQRKIVEEIKETVGER
BLAST of MELO3C031720.2 vs. NCBI nr
Match: XP_008446777.2 (PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Cucumis melo]) HSP 1 Score: 111.3 bits (277), Expect = 1.5e-21 Identity = 56/68 (82.35%), Postives = 60/68 (88.24%), Query Frame = 0
BLAST of MELO3C031720.2 vs. NCBI nr
Match: XP_011655840.1 (PREDICTED: cytochrome P450 77A3-like [Cucumis sativus] >KGN52206.1 hypothetical protein Csa_5G615280 [Cucumis sativus]) HSP 1 Score: 106.7 bits (265), Expect = 3.7e-20 Identity = 57/69 (82.61%), Postives = 60/69 (86.96%), Query Frame = 0
BLAST of MELO3C031720.2 vs. NCBI nr
Match: XP_018853421.1 (PREDICTED: cytochrome P450 77A3-like [Juglans regia]) HSP 1 Score: 82.4 bits (202), Expect = 7.4e-13 Identity = 44/68 (64.71%), Postives = 50/68 (73.53%), Query Frame = 0
BLAST of MELO3C031720.2 vs. NCBI nr
Match: XP_023524895.1 (cytochrome P450 77A3-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 82.0 bits (201), Expect = 9.7e-13 Identity = 44/68 (64.71%), Postives = 48/68 (70.59%), Query Frame = 0
BLAST of MELO3C031720.2 vs. NCBI nr
Match: XP_023549979.1 (cytochrome P450 77A3-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 81.3 bits (199), Expect = 1.6e-12 Identity = 44/68 (64.71%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of MELO3C031720.2 vs. TAIR10
Match: AT5G04660.1 (cytochrome P450, family 77, subfamily A, polypeptide 4) HSP 1 Score: 73.6 bits (179), Expect = 6.2e-14 Identity = 38/67 (56.72%), Postives = 49/67 (73.13%), Query Frame = 0
BLAST of MELO3C031720.2 vs. TAIR10
Match: AT5G04630.1 (cytochrome P450, family 77, subfamily A, polypeptide 9) HSP 1 Score: 72.8 bits (177), Expect = 1.1e-13 Identity = 37/67 (55.22%), Postives = 48/67 (71.64%), Query Frame = 0
BLAST of MELO3C031720.2 vs. TAIR10
Match: AT3G10570.1 (cytochrome P450, family 77, subfamily A, polypeptide 6) HSP 1 Score: 69.3 bits (168), Expect = 1.2e-12 Identity = 36/68 (52.94%), Postives = 48/68 (70.59%), Query Frame = 0
BLAST of MELO3C031720.2 vs. TAIR10
Match: AT3G10560.1 (Cytochrome P450 superfamily protein) HSP 1 Score: 68.2 bits (165), Expect = 2.6e-12 Identity = 34/58 (58.62%), Postives = 42/58 (72.41%), Query Frame = 0
BLAST of MELO3C031720.2 vs. TAIR10
Match: AT2G12190.1 (Cytochrome P450 superfamily protein) HSP 1 Score: 55.1 bits (131), Expect = 2.3e-08 Identity = 25/47 (53.19%), Postives = 35/47 (74.47%), Query Frame = 0
BLAST of MELO3C031720.2 vs. Swiss-Prot
Match: sp|O48928|C77A3_SOYBN (Cytochrome P450 77A3 OS=Glycine max OX=3847 GN=CYP77A3 PE=2 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.3e-13 Identity = 39/68 (57.35%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of MELO3C031720.2 vs. Swiss-Prot
Match: sp|Q9LZ31|C77A4_ARATH (Cytochrome P450 77A4 OS=Arabidopsis thaliana OX=3702 GN=CYP77A4 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.1e-12 Identity = 38/67 (56.72%), Postives = 49/67 (73.13%), Query Frame = 0
BLAST of MELO3C031720.2 vs. Swiss-Prot
Match: sp|P37124|C77A2_SOLME (Cytochrome P450 77A2 OS=Solanum melongena OX=4111 GN=CYP77A2 PE=2 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 9.5e-12 Identity = 39/67 (58.21%), Postives = 45/67 (67.16%), Query Frame = 0
BLAST of MELO3C031720.2 vs. Swiss-Prot
Match: sp|P37123|C77A1_SOLME (Cytochrome P450 77A1 (Fragment) OS=Solanum melongena OX=4111 GN=CYP77A1 PE=2 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 5.2e-10 Identity = 33/68 (48.53%), Postives = 44/68 (64.71%), Query Frame = 0
BLAST of MELO3C031720.2 vs. Swiss-Prot
Match: sp|Q42602|C89A2_ARATH (Cytochrome P450 89A2 OS=Arabidopsis thaliana OX=3702 GN=CYP89A2 PE=2 SV=2) HSP 1 Score: 45.8 bits (107), Expect = 2.5e-04 Identity = 22/55 (40.00%), Postives = 32/55 (58.18%), Query Frame = 0
BLAST of MELO3C031720.2 vs. TrEMBL
Match: tr|A0A1S3BGP7|A0A1S3BGP7_CUCME (LOW QUALITY PROTEIN: cytochrome P450 77A3-like OS=Cucumis melo OX=3656 GN=LOC103489405 PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 9.8e-22 Identity = 56/68 (82.35%), Postives = 60/68 (88.24%), Query Frame = 0
BLAST of MELO3C031720.2 vs. TrEMBL
Match: tr|A0A0A0KWN5|A0A0A0KWN5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G615280 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 2.4e-20 Identity = 57/69 (82.61%), Postives = 60/69 (86.96%), Query Frame = 0
BLAST of MELO3C031720.2 vs. TrEMBL
Match: tr|A0A2I4HB86|A0A2I4HB86_9ROSI (cytochrome P450 77A3-like OS=Juglans regia OX=51240 GN=LOC109015403 PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 4.9e-13 Identity = 44/68 (64.71%), Postives = 50/68 (73.53%), Query Frame = 0
BLAST of MELO3C031720.2 vs. TrEMBL
Match: tr|A0A0A0K9C6|A0A0A0K9C6_CUCSA (Cytochrome P450 77A3 OS=Cucumis sativus OX=3659 GN=Csa_6G044530 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.4e-12 Identity = 43/68 (63.24%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of MELO3C031720.2 vs. TrEMBL
Match: tr|A0A1S3C3N8|A0A1S3C3N8_CUCME (cytochrome P450 77A3-like OS=Cucumis melo OX=3656 GN=LOC103496495 PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 2.4e-12 Identity = 42/68 (61.76%), Postives = 50/68 (73.53%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|