MELO3C031209.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCGATGGCGAGGGCGAGCTCCGACTTGCAATATCCCGACCGGTTCTACATTGCAGCTTCTTATGCCGGTTTTGATGGATCACTAAAATCGTCTTCAAAGGCCCTCAGGTCTATGTTCTCCGATGAGGCCGCTTTGTTACTTTATGGCTTGTATCAGCAGGTACTACCACATGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGTGTTGAGGTTTGA ATGGCTGCGATGGCGAGGGCGAGCTCCGACTTGCAATATCCCGACCGGTTCTACATTGCAGCTTCTTATGCCGGTTTTGATGGATCACTAAAATCGTCTTCAAAGGCCCTCAGGTCTATGTTCTCCGATGAGGCCGCTTTGTTACTTTATGGCTTGTATCAGCAGGTACTACCACATGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGTGTTGAGGTTTGA ATGGCTGCGATGGCGAGGGCGAGCTCCGACTTGCAATATCCCGACCGGTTCTACATTGCAGCTTCTTATGCCGGTTTTGATGGATCACTAAAATCGTCTTCAAAGGCCCTCAGGTCTATGTTCTCCGATGAGGCCGCTTTGTTACTTTATGGCTTGTATCAGCAGGTACTACCACATGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGTGTTGA MAAMARASSDLQYPDRFYIAASYAGFDGSLKSSSKALRSMFSDEAALLLYGLYQQVLPHVLTPVTYRCCFSLC
BLAST of MELO3C031209.2 vs. NCBI nr
Match: XP_004144782.1 (PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform X1 [Cucumis sativus] >KGN60945.1 hypothetical protein Csa_2G030060 [Cucumis sativus]) HSP 1 Score: 96.7 bits (239), Expect = 3.5e-17 Identity = 51/55 (92.73%), Postives = 51/55 (92.73%), Query Frame = 0
BLAST of MELO3C031209.2 vs. NCBI nr
Match: XP_008454338.1 (PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis melo]) HSP 1 Score: 96.7 bits (239), Expect = 3.5e-17 Identity = 51/55 (92.73%), Postives = 51/55 (92.73%), Query Frame = 0
BLAST of MELO3C031209.2 vs. NCBI nr
Match: XP_011648837.1 (PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis sativus]) HSP 1 Score: 96.7 bits (239), Expect = 3.5e-17 Identity = 51/55 (92.73%), Postives = 51/55 (92.73%), Query Frame = 0
BLAST of MELO3C031209.2 vs. NCBI nr
Match: XP_022946642.1 (acyl-CoA-binding domain-containing protein 4-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 95.9 bits (237), Expect = 6.0e-17 Identity = 50/55 (90.91%), Postives = 51/55 (92.73%), Query Frame = 0
BLAST of MELO3C031209.2 vs. NCBI nr
Match: XP_022946643.1 (acyl-CoA-binding domain-containing protein 4-like isoform X2 [Cucurbita moschata]) HSP 1 Score: 95.9 bits (237), Expect = 6.0e-17 Identity = 50/55 (90.91%), Postives = 51/55 (92.73%), Query Frame = 0
BLAST of MELO3C031209.2 vs. TAIR10
Match: AT5G27630.1 (acyl-CoA binding protein 5) HSP 1 Score: 63.2 bits (152), Expect = 7.9e-11 Identity = 35/55 (63.64%), Postives = 41/55 (74.55%), Query Frame = 0
BLAST of MELO3C031209.2 vs. TAIR10
Match: AT3G05420.2 (acyl-CoA binding protein 4) HSP 1 Score: 59.7 bits (143), Expect = 8.7e-10 Identity = 33/53 (62.26%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of MELO3C031209.2 vs. Swiss-Prot
Match: sp|Q8RWD9|ACBP5_ARATH (Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=ACBP5 PE=1 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.4e-09 Identity = 35/55 (63.64%), Postives = 41/55 (74.55%), Query Frame = 0
BLAST of MELO3C031209.2 vs. Swiss-Prot
Match: sp|Q9MA55|ACBP4_ARATH (Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=ACBP4 PE=1 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.6e-08 Identity = 33/53 (62.26%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of MELO3C031209.2 vs. Swiss-Prot
Match: sp|Q75LJ4|ACBP6_ORYSJ (Acyl-CoA-binding domain-containing protein 6 OS=Oryza sativa subsp. japonica OX=39947 GN=ACBP6 PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 6.0e-08 Identity = 31/49 (63.27%), Postives = 36/49 (73.47%), Query Frame = 0
BLAST of MELO3C031209.2 vs. TrEMBL
Match: tr|A0A1S3BZ54|A0A1S3BZ54_CUCME (acyl-CoA-binding domain-containing protein 4 OS=Cucumis melo OX=3656 GN=LOC103494768 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 2.3e-17 Identity = 51/55 (92.73%), Postives = 51/55 (92.73%), Query Frame = 0
BLAST of MELO3C031209.2 vs. TrEMBL
Match: tr|A0A0A0LFW3|A0A0A0LFW3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G030060 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 2.3e-17 Identity = 51/55 (92.73%), Postives = 51/55 (92.73%), Query Frame = 0
BLAST of MELO3C031209.2 vs. TrEMBL
Match: tr|A0A2P6R714|A0A2P6R714_ROSCH (Putative FERM/acyl-CoA-binding protein, 3-helical bundle OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr3g0455341 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 3.5e-13 Identity = 41/55 (74.55%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MELO3C031209.2 vs. TrEMBL
Match: tr|M5WQY4|M5WQY4_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_6G322800 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 6.0e-13 Identity = 41/53 (77.36%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of MELO3C031209.2 vs. TrEMBL
Match: tr|A0A251NYR2|A0A251NYR2_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_6G322800 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 6.0e-13 Identity = 41/53 (77.36%), Postives = 47/53 (88.68%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|