MELO3C031200.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GATGAAGACAAGCACGATGACACCTTATGTGGGGCAGTGAAAACTATGCTTCAGATGAATTTTGGATTTACTGTGATATCTGTAAGAAATGGTTTCATGGAAAATTTGTTGTACAACGAAATGCTTCAGTTTATCAGTTTTCTTGCGATGTATTGAGTTTTCTAAAACAGGGTAAATAACCATGATAATAACCATGATGTAATAACCATGATAATAACCATGATTAATAACCATGATAATAACCATGATGTTTTTTGTTTAGGTTTGTTCTCAAAG GATGAAGACAAGCACGATGACACCTTATGTGGGGCAGTGAAAACTATGCTTCAGATGAATTTTGGATTTACTGTGATATCTGTAAGAAATGGTTTCATGGAAAATTTGTTGTACAACGAAATGCTTCAGTTTATCAGTTTTCTTGCGATGTATTGAGTTTTCTAAAACAGGGATGTTTTTTGTTTAGGTTTGTTCTCAAAG ATGTGGGGCAGTGAAAACTATGCTTCAGATGAATTTTGGATTTACTGTGATATCTGTAAGAAATGGTTTCATGGAAAATTTGTTGTACAACGAAATGCTTCAGTTTATCAGTTTTCTTGCGATGTATTGAGTTTTCTAAAACAGGGATGTTTTTTGTTTAGGTTTGTTCTCAAA MWGSENYASDEFWIYCDICKKWFHGKFVVQRNASVYQFSCDVLSFLKQGCFLFRFVLK
BLAST of MELO3C031200.2 vs. NCBI nr
Match: PWA83770.1 (hypothetical protein CTI12_AA117620 [Artemisia annua]) HSP 1 Score: 59.3 bits (142), Expect = 5.0e-06 Identity = 24/44 (54.55%), Postives = 31/44 (70.45%), Query Frame = 0
BLAST of MELO3C031200.2 vs. NCBI nr
Match: XP_006849596.1 (PHD finger protein ALFIN-LIKE 4 isoform X1 [Amborella trichopoda] >ERN11177.1 hypothetical protein AMTR_s00024p00200570 [Amborella trichopoda]) HSP 1 Score: 57.4 bits (137), Expect = 1.9e-05 Identity = 26/47 (55.32%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of MELO3C031200.2 vs. NCBI nr
Match: XP_011625288.1 (PHD finger protein ALFIN-LIKE 4 isoform X2 [Amborella trichopoda]) HSP 1 Score: 57.4 bits (137), Expect = 1.9e-05 Identity = 26/47 (55.32%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of MELO3C031200.2 vs. NCBI nr
Match: XP_020526131.1 (PHD finger protein ALFIN-LIKE 4 isoform X3 [Amborella trichopoda]) HSP 1 Score: 57.4 bits (137), Expect = 1.9e-05 Identity = 26/47 (55.32%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of MELO3C031200.2 vs. NCBI nr
Match: XP_009769789.1 (PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Nicotiana sylvestris] >XP_016473521.1 PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Nicotiana tabacum]) HSP 1 Score: 57.0 bits (136), Expect = 2.5e-05 Identity = 25/43 (58.14%), Postives = 28/43 (65.12%), Query Frame = 0
BLAST of MELO3C031200.2 vs. TAIR10
Match: AT5G20510.1 (alfin-like 5) HSP 1 Score: 52.0 bits (123), Expect = 1.4e-07 Identity = 21/43 (48.84%), Postives = 26/43 (60.47%), Query Frame = 0
BLAST of MELO3C031200.2 vs. TAIR10
Match: AT5G26210.1 (alfin-like 4) HSP 1 Score: 49.7 bits (117), Expect = 7.2e-07 Identity = 20/39 (51.28%), Postives = 26/39 (66.67%), Query Frame = 0
BLAST of MELO3C031200.2 vs. TAIR10
Match: AT5G05610.1 (alfin-like 1) HSP 1 Score: 49.3 bits (116), Expect = 9.4e-07 Identity = 18/38 (47.37%), Postives = 26/38 (68.42%), Query Frame = 0
BLAST of MELO3C031200.2 vs. TAIR10
Match: AT2G02470.1 (alfin-like 6) HSP 1 Score: 48.5 bits (114), Expect = 1.6e-06 Identity = 17/24 (70.83%), Postives = 20/24 (83.33%), Query Frame = 0
BLAST of MELO3C031200.2 vs. TAIR10
Match: AT1G14510.1 (alfin-like 7) HSP 1 Score: 48.1 bits (113), Expect = 2.1e-06 Identity = 17/24 (70.83%), Postives = 19/24 (79.17%), Query Frame = 0
BLAST of MELO3C031200.2 vs. Swiss-Prot
Match: sp|Q5XEM9|ALFL5_ARATH (PHD finger protein ALFIN-LIKE 5 OS=Arabidopsis thaliana OX=3702 GN=AL5 PE=2 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 2.6e-06 Identity = 21/43 (48.84%), Postives = 26/43 (60.47%), Query Frame = 0
BLAST of MELO3C031200.2 vs. Swiss-Prot
Match: sp|Q40359|ALFIN_MEDSA (PHD finger protein Alfin1 OS=Medicago sativa OX=3879 GN=ALFIN-1 PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 4.4e-06 Identity = 22/46 (47.83%), Postives = 28/46 (60.87%), Query Frame = 0
BLAST of MELO3C031200.2 vs. Swiss-Prot
Match: sp|O81488|ALFL4_ARATH (PHD finger protein ALFIN-LIKE 4 OS=Arabidopsis thaliana OX=3702 GN=AL4 PE=1 SV=2) HSP 1 Score: 49.7 bits (117), Expect = 1.3e-05 Identity = 20/39 (51.28%), Postives = 26/39 (66.67%), Query Frame = 0
BLAST of MELO3C031200.2 vs. Swiss-Prot
Match: sp|B8B8C5|ALFL9_ORYSI (PHD finger protein ALFIN-LIKE 9 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_26819 PE=3 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.3e-05 Identity = 18/24 (75.00%), Postives = 21/24 (87.50%), Query Frame = 0
BLAST of MELO3C031200.2 vs. Swiss-Prot
Match: sp|Q6YTY3|ALFL9_ORYSJ (PHD finger protein ALFIN-LIKE 9 OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0608400 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.3e-05 Identity = 18/24 (75.00%), Postives = 21/24 (87.50%), Query Frame = 0
BLAST of MELO3C031200.2 vs. TrEMBL
Match: tr|A0A2U1PDG5|A0A2U1PDG5_ARTAN (Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA117620 PE=4 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 3.3e-06 Identity = 24/44 (54.55%), Postives = 31/44 (70.45%), Query Frame = 0
BLAST of MELO3C031200.2 vs. TrEMBL
Match: tr|W1PMF2|W1PMF2_AMBTC (Uncharacterized protein OS=Amborella trichopoda OX=13333 GN=AMTR_s00024p00200570 PE=4 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.3e-05 Identity = 26/47 (55.32%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of MELO3C031200.2 vs. TrEMBL
Match: tr|A0A2R6QFD2|A0A2R6QFD2_ACTCH (PHD finger protein ALFIN-LIKE 4, N-terminally processed like OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc17672 PE=4 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.6e-05 Identity = 25/43 (58.14%), Postives = 28/43 (65.12%), Query Frame = 0
BLAST of MELO3C031200.2 vs. TrEMBL
Match: tr|A0A0D6R349|A0A0D6R349_ARACU (Uncharacterized protein OS=Araucaria cunninghamii OX=56994 PE=4 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.6e-05 Identity = 25/43 (58.14%), Postives = 28/43 (65.12%), Query Frame = 0
BLAST of MELO3C031200.2 vs. TrEMBL
Match: tr|A0A1S4AAB9|A0A1S4AAB9_TOBAC (PHD finger protein ALFIN-LIKE 4-like OS=Nicotiana tabacum OX=4097 GN=LOC107795402 PE=4 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.6e-05 Identity = 25/43 (58.14%), Postives = 28/43 (65.12%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|