MELO3C031193.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTGTTTTTTTATTACTATCAAAAGGGCTTGCTCCGGAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGTTGTCTCGATTAGAAAGCATTTGGAAAGGAACAGGAAGGACAAAGACTCCAAGGTACACATTGTACTCT ATGTGTGTTTTTTTATTACTATCAAAAGGGCTTGCTCCGGAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGTTGTCTCGATTAGAAAGCATTTGGAAAGGAACAGGAAGGACAAAGACTCCAAGGTACACATTGTACTCT ATGTGTGTTTTTTTATTACTATCAAAAGGGCTTGCTCCGGAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGTTGTCTCGATTAGAAAGCATTTGGAAAGGAACAGGAAGGACAAAGACTCCAAGGTACACATTGTACTC MCVFLLLSKGLAPEIPEDLYHLIKKVVSIRKHLERNRKDKDSKVHIVL
BLAST of MELO3C031193.2 vs. NCBI nr
Match: ABW90418.1 (putative ribosomal protein S13 [Barentsia elongata]) HSP 1 Score: 76.6 bits (187), Expect = 2.5e-11 Identity = 36/44 (81.82%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C031193.2 vs. NCBI nr
Match: CDW52158.1 (Coq4 and Ribosomal S13 N and Ribosomal S15 and zf-DNL domain containing protein [Trichuris trichiura]) HSP 1 Score: 76.6 bits (187), Expect = 2.5e-11 Identity = 36/44 (81.82%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C031193.2 vs. NCBI nr
Match: KHJ41186.1 (ribosomal protein S15 [Trichuris suis]) HSP 1 Score: 76.6 bits (187), Expect = 2.5e-11 Identity = 36/44 (81.82%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C031193.2 vs. NCBI nr
Match: XP_010853977.1 (PREDICTED: 40S ribosomal protein S13-like [Bison bison bison]) HSP 1 Score: 76.3 bits (186), Expect = 3.3e-11 Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = 0
BLAST of MELO3C031193.2 vs. NCBI nr
Match: XP_001895245.1 (40S ribosomal protein S13 [Brugia malayi] >CDP93253.1 BMA-RPS-13 [Brugia malayi]) HSP 1 Score: 75.9 bits (185), Expect = 4.3e-11 Identity = 36/46 (78.26%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MELO3C031193.2 vs. TAIR10
Match: AT3G60770.1 (Ribosomal protein S13/S15) HSP 1 Score: 73.2 bits (178), Expect = 5.0e-14 Identity = 34/44 (77.27%), Postives = 39/44 (88.64%), Query Frame = 0
BLAST of MELO3C031193.2 vs. TAIR10
Match: AT4G00100.1 (ribosomal protein S13A) HSP 1 Score: 73.2 bits (178), Expect = 5.0e-14 Identity = 34/44 (77.27%), Postives = 39/44 (88.64%), Query Frame = 0
BLAST of MELO3C031193.2 vs. Swiss-Prot
Match: sp|P62299|RS13_BRUPA (40S ribosomal protein S13 OS=Brugia pahangi OX=6280 GN=RPS13 PE=2 SV=2) HSP 1 Score: 74.7 bits (182), Expect = 3.1e-13 Identity = 35/46 (76.09%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MELO3C031193.2 vs. Swiss-Prot
Match: sp|P62300|RS13_WUCBA (40S ribosomal protein S13 OS=Wuchereria bancrofti OX=6293 GN=RPS13 PE=3 SV=2) HSP 1 Score: 74.7 bits (182), Expect = 3.1e-13 Identity = 35/46 (76.09%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MELO3C031193.2 vs. Swiss-Prot
Match: sp|P62302|RS13_SOYBN (40S ribosomal protein S13 OS=Glycine max OX=3847 GN=RPS13 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 4.1e-13 Identity = 35/44 (79.55%), Postives = 39/44 (88.64%), Query Frame = 0
BLAST of MELO3C031193.2 vs. Swiss-Prot
Match: sp|P59223|RS131_ARATH (40S ribosomal protein S13-1 OS=Arabidopsis thaliana OX=3702 GN=RPS13A PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 9.0e-13 Identity = 34/44 (77.27%), Postives = 39/44 (88.64%), Query Frame = 0
BLAST of MELO3C031193.2 vs. Swiss-Prot
Match: sp|P59224|RS132_ARATH (40S ribosomal protein S13-2 OS=Arabidopsis thaliana OX=3702 GN=RPS13B PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 9.0e-13 Identity = 34/44 (77.27%), Postives = 39/44 (88.64%), Query Frame = 0
BLAST of MELO3C031193.2 vs. TrEMBL
Match: tr|A0A0N4V0I2|A0A0N4V0I2_ENTVE (Uncharacterized protein OS=Enterobius vermicularis OX=51028 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.3e-11 Identity = 37/46 (80.43%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MELO3C031193.2 vs. TrEMBL
Match: tr|A0A0N5AK96|A0A0N5AK96_9BILA (Uncharacterized protein OS=Syphacia muris OX=451379 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.3e-11 Identity = 37/46 (80.43%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MELO3C031193.2 vs. TrEMBL
Match: tr|A0A077YXH8|A0A077YXH8_TRITR (Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial OS=Trichuris trichiura OX=36087 GN=TTRE_0000041701 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.7e-11 Identity = 36/44 (81.82%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C031193.2 vs. TrEMBL
Match: tr|A0A0N5DS93|A0A0N5DS93_TRIMR (Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial OS=Trichuris muris OX=70415 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.7e-11 Identity = 36/44 (81.82%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C031193.2 vs. TrEMBL
Match: tr|A8UAD8|A8UAD8_9BILA (Putative ribosomal protein S13 OS=Barentsia elongata OX=478378 PE=2 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.7e-11 Identity = 36/44 (81.82%), Postives = 40/44 (90.91%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|