MELO3C031121.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATAGGTATGTGCATCATCATGGTTGAAATTTAAAACAATTTGAAAATTTTTCCTCTCGTCATGCGTGTACTTCTAATGTCCAAGGTAAGTTAACAAATTGAAAATTGAAATTTTAATCGTTCAGCAAGTTTATTTCCACGTGAAAGTGAGTTATGTATATAATCACTTCAGGCTGTTAGTGATGCCTTTAATGAAAGCCTATATGAAGAGCAAGATCAATTGAAGGGTATTCCATTACTGGAATGA ATAGGTATGTGCATCATCATGGTTGAAATTTAAAACAATTTGAAAATTTTTCCTCTCGTCATGCGTGTACTTCTAATGTCCAAGGCTGTTAGTGATGCCTTTAATGAAAGCCTATATGAAGAGCAAGATCAATTGAAGGGTATTCCATTACTGGAATGA ATGCGTGTACTTCTAATGTCCAAGGCTGTTAGTGATGCCTTTAATGAAAGCCTATATGAAGAGCAAGATCAATTGAAGGGTATTCCATTACTGGAATGA MRVLLMSKAVSDAFNESLYEEQDQLKGIPLLE
BLAST of MELO3C031121.2 vs. NCBI nr
Match: KGN48017.1 (hypothetical protein Csa_6G425060 [Cucumis sativus]) HSP 1 Score: 55.5 bits (132), Expect = 4.0e-05 Identity = 28/32 (87.50%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of MELO3C031121.2 vs. NCBI nr
Match: XP_008449563.1 (PREDICTED: chloride channel protein CLC-d [Cucumis melo]) HSP 1 Score: 55.5 bits (132), Expect = 4.0e-05 Identity = 28/32 (87.50%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of MELO3C031121.2 vs. NCBI nr
Match: XP_011657577.1 (PREDICTED: chloride channel protein CLC-d [Cucumis sativus]) HSP 1 Score: 55.5 bits (132), Expect = 4.0e-05 Identity = 28/32 (87.50%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of MELO3C031121.2 vs. NCBI nr
Match: XP_022959118.1 (chloride channel protein CLC-d isoform X2 [Cucurbita moschata]) HSP 1 Score: 55.5 bits (132), Expect = 4.0e-05 Identity = 28/32 (87.50%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of MELO3C031121.2 vs. NCBI nr
Match: XP_022959117.1 (chloride channel protein CLC-d isoform X1 [Cucurbita moschata]) HSP 1 Score: 55.5 bits (132), Expect = 4.0e-05 Identity = 28/32 (87.50%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of MELO3C031121.2 vs. TAIR10
Match: AT5G26240.1 (chloride channel D) HSP 1 Score: 49.7 bits (117), Expect = 3.9e-07 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = 0
BLAST of MELO3C031121.2 vs. Swiss-Prot
Match: sp|P92943|CLCD_ARATH (Chloride channel protein CLC-d OS=Arabidopsis thaliana OX=3702 GN=CLC-D PE=1 SV=2) HSP 1 Score: 49.7 bits (117), Expect = 7.1e-06 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = 0
BLAST of MELO3C031121.2 vs. TrEMBL
Match: tr|A0A1S3BMB3|A0A1S3BMB3_CUCME (Chloride channel protein OS=Cucumis melo OX=3656 GN=LOC103491408 PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 2.6e-05 Identity = 28/32 (87.50%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of MELO3C031121.2 vs. TrEMBL
Match: tr|A0A0A0KI42|A0A0A0KI42_CUCSA (Chloride channel protein OS=Cucumis sativus OX=3659 GN=Csa_6G425060 PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 2.6e-05 Identity = 28/32 (87.50%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of MELO3C031121.2 vs. TrEMBL
Match: tr|A0A2N9H2I9|A0A2N9H2I9_FAGSY (Chloride channel protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS36619 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 1.7e-04 Identity = 26/32 (81.25%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of MELO3C031121.2 vs. TrEMBL
Match: tr|A0A2P4LVL3|A0A2P4LVL3_QUESU (L-ascorbate oxidase OS=Quercus suber OX=58331 GN=CFP56_42428 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 1.7e-04 Identity = 26/32 (81.25%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of MELO3C031121.2 vs. TrEMBL
Match: tr|A0A2P4LW82|A0A2P4LW82_QUESU (Chloride channel protein clc-d OS=Quercus suber OX=58331 GN=CFP56_42428 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 1.7e-04 Identity = 26/32 (81.25%), Postives = 28/32 (87.50%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |