MELO3C030746.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTCTGTTGAAACTATCAATCATGTTATGTACGATGTTATTTAGTCTTTCCCTTTCAGGGGCCACTTCACCCAAAAACATATTCATTCTCGCTGGCCAGAGCAACATAGCTGGTCGAGGTGGGGTTGAGAAAGATCAATTAGGAAACCTCGTATGGGATAGGTTAGTCCCACCAGAATGTGAACCTCAACCATCAATCCTACGATTGAACCCTGAGCGCTAA ATGGCTCTGTTGAAACTATCAATCATGTTATGTACGATGTTATTTAGTCTTTCCCTTTCAGGGGCCACTTCACCCAAAAACATATTCATTCTCGCTGGCCAGAGCAACATAGCTGGTCGAGGTGGGGTTGAGAAAGATCAATTAGGAAACCTCGTATGGGATAGGTTAGTCCCACCAGAATGTGAACCTCAACCATCAATCCTACGATTGAACCCTGAGCGCTAA ATGGCTCTGTTGAAACTATCAATCATGTTATGTACGATGTTATTTAGTCTTTCCCTTTCAGGGGCCACTTCACCCAAAAACATATTCATTCTCGCTGGCCAGAGCAACATAGCTGGTCGAGGTGGGGTTGAGAAAGATCAATTAGGAAACCTCGTATGGGATAGGTTAGTCCCACCAGAATGTGAACCTCAACCATCAATCCTACGATTGAACCCTGAGCGCTAA MALLKLSIMLCTMLFSLSLSGATSPKNIFILAGQSNIAGRGGVEKDQLGNLVWDRLVPPECEPQPSILRLNPER
BLAST of MELO3C030746.2 vs. NCBI nr
Match: XP_022158585.1 (probable carbohydrate esterase At4g34215 [Momordica charantia]) HSP 1 Score: 115.9 bits (289), Expect = 5.7e-23 Identity = 59/74 (79.73%), Postives = 65/74 (87.84%), Query Frame = 0
BLAST of MELO3C030746.2 vs. NCBI nr
Match: XP_022131651.1 (probable carbohydrate esterase At4g34215 [Momordica charantia]) HSP 1 Score: 115.5 bits (288), Expect = 7.5e-23 Identity = 59/74 (79.73%), Postives = 65/74 (87.84%), Query Frame = 0
BLAST of MELO3C030746.2 vs. NCBI nr
Match: XP_022158365.1 (probable carbohydrate esterase At4g34215 [Momordica charantia]) HSP 1 Score: 112.8 bits (281), Expect = 4.8e-22 Identity = 57/74 (77.03%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of MELO3C030746.2 vs. NCBI nr
Match: XP_011649575.1 (PREDICTED: probable carbohydrate esterase At4g34215 [Cucumis sativus] >KGN62479.1 hypothetical protein Csa_2G356040 [Cucumis sativus]) HSP 1 Score: 112.5 bits (280), Expect = 6.3e-22 Identity = 56/72 (77.78%), Postives = 62/72 (86.11%), Query Frame = 0
BLAST of MELO3C030746.2 vs. NCBI nr
Match: XP_011650180.1 (PREDICTED: uncharacterized protein LOC101219489 [Cucumis sativus]) HSP 1 Score: 112.5 bits (280), Expect = 6.3e-22 Identity = 55/74 (74.32%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of MELO3C030746.2 vs. TAIR10
Match: AT4G34215.1 (Domain of unknown function (DUF303) ) HSP 1 Score: 66.2 bits (160), Expect = 9.4e-12 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 0
BLAST of MELO3C030746.2 vs. TAIR10
Match: AT3G53010.1 (Domain of unknown function (DUF303) ) HSP 1 Score: 61.6 bits (148), Expect = 2.3e-10 Identity = 30/45 (66.67%), Postives = 34/45 (75.56%), Query Frame = 0
BLAST of MELO3C030746.2 vs. Swiss-Prot
Match: sp|Q8L9J9|CAES_ARATH (Probable carbohydrate esterase At4g34215 OS=Arabidopsis thaliana OX=3702 GN=At4g34215 PE=1 SV=2) HSP 1 Score: 66.2 bits (160), Expect = 1.7e-10 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 0
BLAST of MELO3C030746.2 vs. TrEMBL
Match: tr|A0A0A0LNC5|A0A0A0LNC5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G356040 PE=4 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 4.2e-22 Identity = 56/72 (77.78%), Postives = 62/72 (86.11%), Query Frame = 0
BLAST of MELO3C030746.2 vs. TrEMBL
Match: tr|A0A1S4DVE0|A0A1S4DVE0_CUCME (probable carbohydrate esterase At4g34215 OS=Cucumis melo OX=3656 GN=LOC103487864 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 1.1e-19 Identity = 51/74 (68.92%), Postives = 60/74 (81.08%), Query Frame = 0
BLAST of MELO3C030746.2 vs. TrEMBL
Match: tr|E5GB85|E5GB85_CUCME (Uncharacterized protein OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 1.1e-19 Identity = 51/74 (68.92%), Postives = 60/74 (81.08%), Query Frame = 0
BLAST of MELO3C030746.2 vs. TrEMBL
Match: tr|A0A1S3CSF8|A0A1S3CSF8_CUCME (probable carbohydrate esterase At4g34215 OS=Cucumis melo OX=3656 GN=LOC103504372 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.3e-12 Identity = 36/38 (94.74%), Postives = 37/38 (97.37%), Query Frame = 0
BLAST of MELO3C030746.2 vs. TrEMBL
Match: tr|A0A218X8I9|A0A218X8I9_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CDL15_Pgr006722 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 8.7e-12 Identity = 33/47 (70.21%), Postives = 41/47 (87.23%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|